SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000004406 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000004406
Domain Number 1 Region: 5-135
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.19e-18
Family Clostridium neurotoxins, the second last domain 0.034
Further Details:      
 
Domain Number 2 Region: 226-346,411-478
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 0.00000000000000234
Family Reprolysin-like 0.067
Further Details:      
 
Domain Number 3 Region: 358-519
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 0.0000000000265
Family Reprolysin-like 0.085
Further Details:      
 
Domain Number 4 Region: 1207-1279
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000306
Family Complement control module/SCR domain 0.003
Further Details:      
 
Weak hits

Sequence:  ENSDORP00000004406
Domain Number - Region: 1271-1306
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000373
Family Complement control module/SCR domain 0.0079
Further Details:      
 
Domain Number - Region: 1071-1110
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00057
Family Complement control module/SCR domain 0.0075
Further Details:      
 
Domain Number - Region: 1183-1212
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00311
Family Complement control module/SCR domain 0.0081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000004406   Gene: ENSDORG00000004708   Transcript: ENSDORT00000004709
Sequence length 1488
Comment pep:novel genescaffold:dipOrd1:GeneScaffold_5877:145095:330442:1 gene:ENSDORG00000004708 transcript:ENSDORT00000004709 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LYDKCSYTSRDQGWVVGIHTVGDQGNRDPRYFFSLKTDRARQVTTINAHRSYLPGQWVFL
AATYDGRLMKLYVNGAQVANSGGQVGGIFSPLTQKCKVLMLGGSTLSHNYRGYIEHFRLW
KVARTQREILLDMENHGLYTPLPQLLLQENWDNVQRIWSPMKDGHSPRVELSNAHGFLLD
TNLEPPLCGQTLCDNKEVIASYNQLPRFRQPKVVRYRVVNLYDDDHENPTVSRQQVDFQH
QQLAEAFQHYNISWELEVLEVNNSSLRHRLILANCDISKIGDESCDPECNHTLTGHDGGD
CRHLRYPAFMKKQQNGVCDMDCNYERFNFDGGECCDPNITNVTETCFDPDSPHRAYLDVN
ELKNILRLDGSTHLNIFFAKSSEEELAGVATWPWDKEALMHLGGIVLNPSFYGTPGHTHT
MIHEIGHSLGLYHIFRGISEIQSCSDPCMETEPSFETGDLCNDTNPAPKHKLCGDPGPEN
DTCGFHSFVNTPYNNFMSYADDDCTDSFTPNQVARMHCYLDLVYQGWQPSRKPAPVALAP
QVVGHTADSVMLEWFPPIDGHFFQRELGSACDLCLEGRILVQYALKASSPMPCGPSGHWS
PREAEGHPDVEQPCKSSVRTWSPNSAVNPHTVPPACPEPQGCYLELEFRYPLVPESLTLW
VTFVSTDWDSSGAVNDIKLLTVSGKNISLGPQNVFCDIPLTIRVRDVGEEIRGIQIYTLD
EHLEIDAAMLTSTADTPLCLGCKPLQYKVVRDPPLQAEMASLLHLNRRFMDXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDQGEECDDMNKMNGDGCSLFCQKEV
SFNCLDEPSRCYFHDGDGVCEEFEQKTSIKDCGVYTPHGFLDQWASNASVSHQDQQCPGW
VVIGQPAASQICRTKVIDLSEGISQHAWYPCTISYPYSQVSQTSFWLQTYFSQPMVATAV
IVHLVTDGTYYGDQKQETISVQLLDTKDQSHDLXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXCVHFACETIDCPELV
VKNSSLNCSSSDRYHGAQCTVSCQTGYVLQIQRDDELIKSQXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNNSFLTCMEDGLWSFPE
ALCELMCLAPPPIPNADLQTPRCHENKHKVGSFCKYKCKPGYHVPGPSRKSKKRAFKTQC
TQDGSWQEGACVPVTCDPPPPKFHGLYQCTNGFQFNSECRIKCEDSSSSQXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXRIVCTAGLKWYPHPAVIHCVKGCEPFMGDNYCDAINNRAFCNYD
GGDCCTSTVKTKKVTPFPMSCDLQEDCACRDPEAQEHSRKDLRGYSHG
Download sequence
Identical sequences ENSDORP00000004406 ENSDORP00000004406

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]