SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000004411 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000004411
Domain Number 1 Region: 371-648
Classification Level Classification E-value
Superfamily NHL repeat 5.75e-29
Family NHL repeat 0.0023
Further Details:      
 
Domain Number 2 Region: 16-78
Classification Level Classification E-value
Superfamily RING/U-box 0.0000000000000259
Family RING finger domain, C3HC4 0.0074
Further Details:      
 
Domain Number 3 Region: 98-159
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.000000458
Family B-box zinc-binding domain 0.0056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000004411   Gene: ENSDORG00000004717   Transcript: ENSDORT00000004715
Sequence length 656
Comment pep:novel genescaffold:dipOrd1:GeneScaffold_5877:508816:510786:1 gene:ENSDORG00000004717 transcript:ENSDORT00000004715 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAAAVAASHLNLDALREVLECPICMESFTEEQLRPKLLHCGHTICRQCLEKLLASSING
VRCPFCSKITRITSLTQLTDNLTVLKIIDTAGLSEAVGLLMCRACGRRLPRQFCRSCGLV
LCEPCREAEHQPPAHCTLPVKEAAEERRRDFGEKLTRLRELMGELQRRKVALEGVSKDLQ
ARYKAVLQEYGHEERRIQEELARSRKFFTGSLAEVEKSNSQVVEEQSYLLNIAEVQAVSR
CDYFLAKIKQADVALLEETADEEEPELTASLPRELTLQDVELLKVGHVGPLQIGQAVKKP
RTVNMEDSWTMEAAAAPAACTSVTFREMDMSPEEVVASPRASPARQRSSETAASIQQCLF
LKKMGAKGSTPGMFNLPVSLYVTSQGEVLVADRGNYRIQVFTRKGFLKEIRRSPSGIDSF
VLSFLGADLPNLTPLSVAMNCHGLIGVTDSYDNSLKVYTMDGHCVACHRSQLSKPWGITA
LPSGQFVVTDVEGGKLWCFTVDRGAGVVKYSCLCSAVRPKFVTCDAEGTVYFTQGLGLNL
ESRQNEHHLEGGFSIGSVGPDGQLGRQISHFFSENEDFRCIAGMCVDARGDLIVADSSRK
EILHFPKGGGYSVLIREGLTCPVGIALTPKGQLLVLDCWDHCIKIYSYHLRRYSTP
Download sequence
Identical sequences ENSDORP00000004411 ENSDORP00000004411

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]