SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000004427 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000004427
Domain Number 1 Region: 376-428
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000905
Family Classic zinc finger, C2H2 0.013
Further Details:      
 
Domain Number 2 Region: 220-277
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000374
Family Classic zinc finger, C2H2 0.019
Further Details:      
 
Domain Number 3 Region: 182-234
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000235
Family Classic zinc finger, C2H2 0.018
Further Details:      
 
Domain Number 4 Region: 267-315
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000405
Family Classic zinc finger, C2H2 0.031
Further Details:      
 
Weak hits

Sequence:  ENSDORP00000004427
Domain Number - Region: 432-462
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00227
Family Classic zinc finger, C2H2 0.031
Further Details:      
 
Domain Number - Region: 351-385
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0185
Family Classic zinc finger, C2H2 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000004427   Gene: ENSDORG00000004733   Transcript: ENSDORT00000004732
Sequence length 464
Comment pep:novel scaffold:dipOrd1:scaffold_28161:2261:6882:1 gene:ENSDORG00000004733 transcript:ENSDORT00000004732 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SSGVSRIADGFNGIFSDHCYSVCSIRQPDLKYFDNKDDDSDTETSNDLPKFADGIKARNR
NQNYLVPGPILRILDHAAFPTEKSDIEICDEECDSPESLYQQTQDESPVEVHTAEEVPVA
IEVHAISEDYDIETENNSSESLPDQTDEEPPAKFCKIIDKSQALNVTAQQKWPLLRANSS
GLYKCELCEFNSKYFSDLKQHMILKHKRTDSNVCRICKESFSTNMLLIEHAKLHEEDPYI
CKYCDYKTVIFENLSQHIADIHFSDHLYWCEQCDVQFSSSSELYLHFQEHSCDEQYLCQF
CEHETNDPEDLHSHVVNEHACKLIELSDKCNSGEHGQYSLLSKITFDKCKNFFVCQVCGF
RSRLHTNVNRHVAIEHTKIYPHVCDDCGKGFSSMLEYCKHLNSHLSERIYLCQYCEYSTG
QIEDLKIHLDFKHSAELPHKCSDCLMRFGNERELISHLPVHETT
Download sequence
Identical sequences ENSDORP00000004427 ENSDORP00000004427

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]