SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000004434 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000004434
Domain Number 1 Region: 1046-1096
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000223
Family Classic zinc finger, C2H2 0.017
Further Details:      
 
Domain Number 2 Region: 925-977
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000106
Family Classic zinc finger, C2H2 0.022
Further Details:      
 
Domain Number 3 Region: 1193-1244
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000577
Family Classic zinc finger, C2H2 0.073
Further Details:      
 
Weak hits

Sequence:  ENSDORP00000004434
Domain Number - Region: 636-689
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000552
Family Classic zinc finger, C2H2 0.028
Further Details:      
 
Domain Number - Region: 805-844
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000596
Family Classic zinc finger, C2H2 0.042
Further Details:      
 
Domain Number - Region: 1286-1308
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00138
Family Classic zinc finger, C2H2 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000004434   Gene: ENSDORG00000004740   Transcript: ENSDORT00000004739
Sequence length 1322
Comment pep:novel genescaffold:dipOrd1:GeneScaffold_599:80639:153190:1 gene:ENSDORG00000004740 transcript:ENSDORT00000004739 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ECSRVTVTEHWPKVFPKGQGSQEHLIKFMTMGDMKTPDFDDLLAAFDIPDMVDPKAAIES
GHDDHESHIKQNAHVDDDSHTPSSSDVGVSVIVKNVRNIDSSEGAEKEGHNPTGNGLHNG
FLTASSLDGYSKDGAKSLKGDAPTSEVTLKDSAFSQFSPISSAEEFDDDEKIEVDDPSDK
EEVRSGFRSNVLTGSVSQQDCDKLKALGGENSGKTGMATPGSLDKNKVKRETESNSISLS
VYESFKVRKLEDKLKENSEKVLENRVLDGKLSLEKNDISLAGLAPSKTKAASKLSSCIAA
IAALSAKKAASDSCKESVANSREASPLPKEENDSPRPADKSPESQSLIDGPKKASLKPSD
SPRSISSENSSKGSPASPAGPTPAIPKVRIKTIKTSSGEIKRTVTRVLPEVDLDSGKKPS
EQTASVMASVTSLLSSPASATVLSSPTRAPLQAVSSAELTPKQVTIKPVATAFLPVSAVK
TAGSQVINLKLANNTTVKATVISAASVQSASSAIIKAANAIQQQTVVVPASSLANAKLVP
KTVHLANLNLLPQGAQATSELRQVLTKPQQQIKQAIINAAASQPPKKVSRVQVVSSLQSS
VVEAFNKVLSSVNPVPVYIPNLSPPANAGITIPTRGYKCLECGDSFALEKSLTQHYDRRS
VRIEVTCNHCTKNLVFYNKCSLLSHARGHKEKGVVMQCSHLILKPVPADQMIVSPSSNTS
ASSPTLQSSVGAGTHTVTKIQSGITGTVISAPSSTPISPAMPLDEDPSKLCRHSLKCLEC
NEVFQDETSLATHFQQAADTSGQKTCTICQMLLPNQCSYASHQRIHQHKSPFSCPECGAI
CRSVHFQTHVTKNCLHYTRRVGFRXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXVIYKCAMCDTVFTLQTLLYRHFDQHIENQKVSVFKCP
DCSLLYAQKQLMMDHIKSMHGTLKSIQGPPNLGIHLPLSIKPASQNSSNHSKEDTKSMNG
KEKLEKKSPSPAKKSVESKKSTILGWTCWECDRLFTQREVYISHMRKEHGKQMKKHPCRQ
CDKSFSSSHSLCRHNRIKHKGIRKVYTCSHCPDSRRTFTKRLMLEKHVQLMHGIKDPDLK
EMTEATNEEEVEIKEDTKAPSPKRKLEEPVLEFRPPRGAITQPLKKLKINVFKVHKCAVC
GFTTENLLQFHEHIPQHKSDGSSYQCRECGLCYTSHVSLSRHLFIVHKLKEPQPATKQNG
AGEDGQQENQPGPDDEAADGAVSDRKCKVCAKTFETEAALNTHMRTHGMAFIKSKRMSAA
DK
Download sequence
Identical sequences ENSDORP00000004434 ENSDORP00000004434

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]