SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000004460 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000004460
Domain Number 1 Region: 1802-1850
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000346
Family Classic zinc finger, C2H2 0.003
Further Details:      
 
Domain Number 2 Region: 189-239
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000042
Family Classic zinc finger, C2H2 0.0091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000004460   Gene: ENSDORG00000004767   Transcript: ENSDORT00000004767
Sequence length 2243
Comment pep:novel genescaffold:dipOrd1:GeneScaffold_100:26942:47080:-1 gene:ENSDORG00000004767 transcript:ENSDORT00000004767 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDTGDTALGQKATSRSGETDKASGRWRQEPSAVIKMSTFGSQEGQRQPQLDPEQIGSTAS
AQLFGSGKLASPGDVLQQVTEKQYPPHRPSPYSCQHSLSFPQPSLPQGIMHSNKPHQSLE
SPPWLFPGPLPSVASEDLYPFPLHGHSGGYPRKKISSLNPAYSQYSQKSIEQAEDAHKKE
HKPKKPGKYICPYCSRACAKPSVLKKHIRSHTGERPYPCIPCGFSFKTKSNLYKHRKSHA
HAIKAGLVPFTESAVSKLDLEAGFIDVEAEIHSDGEQSTDTDEESSLLAETSDKMSPGPP
GIPLELAGRGGYHGSLEESLGGPMKVPILIIPKSGIPLPSESSAYLGPDVLPNPSFNPRA
DDSHTVKQKLALRLSEKRGQDSEPSLNLLSPHSKGSTDSGYFSRSESAEQQISPPNTNAK
SYEEIIFGKYCRLSPRTALSVTPPGPERGPAGRKGMAEPPPPVHARLDVQMFEDPISQLM
SAPAEADPGPAGLLTSSSARFNSEASQPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXHNIQVPEIRVTEEP
DKPEKEKEAPSKEPEKPAEEFQWPQRSETLSQLPAEKLPPKKKRLRLADMEHSSGESSFE
STGTGLSRSPSQESNLSHSSSFSMSFEREETVKLAAPPKQDEFGKHSEFLTVPTGSYSLS
VPGHHHQKEMRRCSSEQMPCPHPTEVPEIRSKSFDYGNLSHAPVAGASTSTLSPSRERKK
CFLVRQASFSGSPEIAQGEAGVDPGVKQEQMEQLHAGLRATWHPGPSSMLPPLPTEDPGK
QSVGPCAPLSSGPLHLAQPQIMHMDSQEPSRNPLLQPTSYMTSKHLSEQPHLFAHQETIP
FSPIQNTLFQFQYPTVCMVHLPTQQPPWWQAHFPPSFTQHPQKSYSKPSFQAEIHSSYPL
EHIAEHARKKSADHVHTKEQTYPCYSGTSGLHSKNLSPKFPSEPSSKSTETPSEQLLQEE
FASANAGPLQSLPGTVVPVRLQTHVPSYGSVMYTSISQILGQNSPAIVICKVDENMTQRT
LVTNAAMQGIGFNIAQVLGPHAGLEKYPLWKVPQTLPLGLESSIPLCLPSTSDSAASLGG
SKRMLSPASSLELFMETKQQKRVKEEKMYGQIVEELSAVELTNSDMKKGLSRPQKPQLVR
QGCASEPKDGLQSRSSSFSSLSPSSSQDYPSASGPSREPFPPSRELLSGSRAPPSGQKSR
RLSDSRESSDELDIDETASDMSMSPQSSSLPTGDSQQEEEGKGRKMPVGMLVHVASGPGG
NVANSTLLFTDVADFQQILQFPSLRTTTTVSWCFLNYTKPNFVQQATFKSSVYASWCISS
CNPNPSGLNTKTTLALLRSKQKITAEIYTLAAMHRPGTGKLTSSGAWKQFAQXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXYKSNEDYVYVRGRGRG
KYICEECGIRCKKPSMLKKHIRTHTDVRPYVCKLCNFAFKTKGNLTKHMKSKAHMKKCLE
LGVSMTSVDDTETEEAENMEDLHKAAEKHSMSSISTDHQFSDAEESDGEDGDDNDDDDED
DDDFDDQGDLTPKTRSRSTSPQPPRFSSLPVNVGTVPHGVPSDSSLGHSSLISYLVTLPS
IQVTQLMTPSDSCEDTQMTEYQRLFQSKSTDSEPDKDRLDIPSVMDEEGMLSSEPSSSPR
DFSPSSRHSSPGYDSSPCRDNSPKRYLIPKGDLSPRRHLSPRRELSPMRHLSPRKEAALR
REMSQRDASPRRHLSPRRPLSPGKDITVRRDLSPRRERRYMTTIRAPSPRRALYHNPPLS
MGQYLQAEPIVLGPPNLRRGLPQVPYFSLYGDQEGAYEHPGSSLFPEGPTDYVFSHLPLH
SQVRAPIPVPVGGIQVHSMPPAL
Download sequence
Identical sequences ENSDORP00000004460 ENSDORP00000004460

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]