SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000004475 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000004475
Domain Number 1 Region: 37-128
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 1.88e-37
Family SCAN domain 0.0000402
Further Details:      
 
Domain Number 2 Region: 458-510
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.97e-17
Family Classic zinc finger, C2H2 0.0071
Further Details:      
 
Domain Number 3 Region: 397-469
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000139
Family Classic zinc finger, C2H2 0.0068
Further Details:      
 
Domain Number 4 Region: 230-279
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 0.00000000157
Family KRAB domain (Kruppel-associated box) 0.0087
Further Details:      
 
Domain Number 5 Region: 496-561
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000303
Family Classic zinc finger, C2H2 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000004475   Gene: ENSDORG00000004781   Transcript: ENSDORT00000004783
Sequence length 578
Comment pep:novel genescaffold:dipOrd1:GeneScaffold_3131:9079:13089:-1 gene:ENSDORG00000004781 transcript:ENSDORT00000004783 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAALEPEEQELWEEEGILMVKLEDDLACWPASRREEPVLETSYQNFRCFRYQEAASPRE
ALTRLRELCRQWLRPERRTKEQILELLVLEQFLTVLPGDLQSWVRGQRPESGEEAVTLVE
GLQKQPRSPRRWVTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXVPAPQEPGPPVERGLGDPSMAALLAALSQGLATFKDV
AVYLSQEQWGDLEPTQEFYGEYVLEEDCGIVVSLSFPIPRLQDTALGEGEPQIPDDQELE
EPEILSFTYTGDRSGDEHECAAQEGGSAEDTRGPARGDQAAARTPDCQGVVEDSRDRIHK
WRLGGRNSQVSGVTSLEDTPAPPVSEQGCGCPVCGKSFRCNSHVVRHLRTHTGERPYKCV
ECEKSYTRSAHLARHQKVHDAHKRPPPRRPGEERAAERPYACGDCGKCFRWASDLARHRR
THTGERPFHCTTCGKSFGQKSVLVCHQATHRDKPYVCCECREEFGDHRSFLAHREVHAVV
RELSLSSTAAEERRFSCPACEGFSRYHLTRHRRTHGET
Download sequence
Identical sequences ENSDORP00000004475 ENSDORP00000004475

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]