SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000004583 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000004583
Domain Number 1 Region: 435-657
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 2.75e-43
Family DBL homology domain (DH-domain) 0.00055
Further Details:      
 
Domain Number 2 Region: 223-355
Classification Level Classification E-value
Superfamily BRCT domain 1.6e-24
Family DNA topoisomerase II binding protein 1, TopBP1 0.05
Further Details:      
 
Domain Number 3 Region: 648-793
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000184
Family Pleckstrin-homology domain (PH domain) 0.0083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000004583   Gene: ENSDORG00000004898   Transcript: ENSDORT00000004898
Sequence length 800
Comment pep:novel genescaffold:dipOrd1:GeneScaffold_1901:373:35791:1 gene:ENSDORG00000004898 transcript:ENSDORT00000004898 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADNSISISTLGRTCLADSSIFEAKVVEASKEHLYIGSASNVEEEMPQVETRVIMVQEAG
KQEELVKALETIKIMEIPVIKIKESCPGKADEKLVKSIVTMETQMSYARMESVNELEGLD
SPEFENVFVVPDFQDSVFNDLHKADCRIIGPPVLLSCAQKGEXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXVRLVTLVHHMGGVIRKDFNSKVTHLVANCTEGEKFRVAVSLGTPIVKP
EWIYKAWERRDEQNFCAAVDDFRNEFKVPPFQDCILSFLGFSDEERTNMEEMTEMQGGNY
LPVGDERCTHLIVEENTVKELPFEPSKKLYVVKQEWFWGSIQMDARAGETMYFYHKANTP
ELKKSVSLLSLNTPNSNRKRRRLKETLAQLSRETDMSPFPPRKRPSAEHSLSIGSLLDIS
NTPESSINCGDTPKSCTKSSKNSTPVPSKQSARWQVAKELYQTESNYVNILATIIQLFQV
PLEEEGQRGGPILAPEEIKTIFGSIPDIFDVHTKIKDDLEDLIVNWDESKSIGDIFLKYS
KDLVKTYPPFVNFFEMSKETIIKCEKQKPRFHAFLKINQAKPECGRQSLVELLIRPVQRL
PSVALLLNXXXXXXXXXXXXXXXXXXXXXXXXXXXXHINEDKRKTEAQKQIFDVVYEVDG
CPANLLSSHRSLVQRVETISLGEYPCDRGEQVTLFLFNDCLEIARKRHKVIGTFKSPPGH
TRPPASLKHIHLMPLSQIKKVLDIRETEDCHNAFALLVRPPTEQANVLLSFQMTSDDLPK
ENWLKMLCRHVANTICKADA
Download sequence
Identical sequences ENSDORP00000004583 ENSDORP00000004583

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]