SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000004596 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000004596
Domain Number 1 Region: 161-277
Classification Level Classification E-value
Superfamily C-type lectin-like 8.06e-40
Family Link domain 0.0017
Further Details:      
 
Domain Number 2 Region: 47-160
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000653
Family V set domains (antibody variable domain-like) 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000004596   Gene: ENSDORG00000004912   Transcript: ENSDORT00000004911
Sequence length 278
Comment pep:novel genescaffold:dipOrd1:GeneScaffold_6194:1114:3585:-1 gene:ENSDORG00000004912 transcript:ENSDORT00000004911 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VCARGTPGPSALWTMAWGLLLLTAPAWAQRGRKKVVHVLEGESGSVVVQTAPGEVVSHRG
GTIVLPCRYHYEAAADDQDGVRLKWTKVVDPLAFADVFVALGPQHRAFGSYRGRAELQND
GPGDASLVLRNVTLQDYGRYECEVTNELEDDAGMVKLDLEGVVFPYHPRGGRYKLTFAEA
QRACAEQDGILASAEQLHAAWRDGLDWCNAGWLRDGSVQYPVSRPREPCGGLGGGSPGAA
GGANGGVRNYGYRHNAEERYDAFCFTSNLPGRVFFLKP
Download sequence
Identical sequences ENSDORP00000004596 ENSDORP00000004596

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]