SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000004606 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000004606
Domain Number 1 Region: 188-300
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.09e-17
Family Spermadhesin, CUB domain 0.0046
Further Details:      
 
Domain Number 2 Region: 136-173
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000262
Family LDL receptor-like module 0.0018
Further Details:      
 
Domain Number 3 Region: 395-432
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000034
Family LDL receptor-like module 0.00081
Further Details:      
 
Domain Number 4 Region: 33-133
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.00000406
Family Spermadhesin, CUB domain 0.0044
Further Details:      
 
Weak hits

Sequence:  ENSDORP00000004606
Domain Number - Region: 326-350
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000107
Family LDL receptor-like module 0.003
Further Details:      
 
Domain Number - Region: 353-394
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0012
Family LDL receptor-like module 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000004606   Gene: ENSDORG00000004922   Transcript: ENSDORT00000004922
Sequence length 710
Comment pep:novel genescaffold:dipOrd1:GeneScaffold_6400:8006:13313:1 gene:ENSDORG00000004922 transcript:ENSDORT00000004922 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLPVSLLLLLVGAVAHSDRIAAPNPACEAPPAVLLEVQGTLQRPLSRESRSSPANCTWLI
LGSKEQTVTIFQKLHLACSSERLILHSPLQPLISLCEAPASPLQLPGGNVTITYSYAGAK
KSVQGFLLSYSQDWLMCLQEEFQCLNHRCIPAAQRCDGINACGDGSDEAGCNSDPFPSLT
LAPGPTLPCNLTLEDFYGVFSSPGYSHLASVSHPQSCLWLLDPHDGRRLAVRFTALDLGY
GDAVHVYDGAGPPETPRLLRSLTHFSNGKAVTVETLSGQAVVAYHTVAWSNGRGFNATYH
VRGYCLPWDRPCGLGLGLEAGESLGERCYSEAQRCDGSWDCADGTDEQDCPGCPPGHFPC
GAAGTPGATACYLPADRCNYQTFCADGADERRCRHCQPGNFRCRDEKCVYETWVCDGQPD
CADGSDEWDCSYSLPRKVITAAVIGSLVCGLLLVIALGCTCKLYAIRTQEYSIFAPLSRM
EAEIVQQQAPPSYGQLIAQGAIPPVEDFPTENPNDNSVLGNLRSLLQILRQDMTPGGASS
GRRRQRGRSVRRLVRRLRRWGLLPRANPPARASDTRPQATPAPPLEVQDGSTSPAHEGGA
VGGQDGEQAPPLPIKSPLPPANTSPVVPLAVSEAQGTLPSVPLEPSLLSGVVQALRGHLL
PSLWPPGPAWTPPGPHTAVLAPEDEDDVLLMPLAEPEVWVVEAEDEPLLA
Download sequence
Identical sequences ENSDORP00000004606 ENSDORP00000004606

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]