SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000004673 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000004673
Domain Number 1 Region: 72-161
Classification Level Classification E-value
Superfamily C-type lectin-like 1.15e-23
Family C-type lectin domain 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000004673   Gene: ENSDORG00000004996   Transcript: ENSDORT00000004996
Sequence length 162
Comment pep:novel genescaffold:dipOrd1:GeneScaffold_4979:2758:10376:1 gene:ENSDORG00000004996 transcript:ENSDORT00000004996 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGKEKCRKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXWGCCPAGWRSLGPGCLLPLSGNSSWADSERNCSNMGAHLASIST
QAELDFATQFLQSGFPYFLGLIYEESGQQWQWVDGTPFDPHA
Download sequence
Identical sequences ENSDORP00000004673 ENSDORP00000004673

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]