SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000004703 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000004703
Domain Number 1 Region: 378-459,763-938
Classification Level Classification E-value
Superfamily NAD kinase/diacylglycerol kinase-like 1.05e-42
Family Diacylglycerol kinase-like 0.013
Further Details:      
 
Domain Number 2 Region: 88-186
Classification Level Classification E-value
Superfamily PH domain-like 1.12e-18
Family Pleckstrin-homology domain (PH domain) 0.0051
Further Details:      
 
Domain Number 3 Region: 239-301
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.000000000000012
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.00011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000004703   Gene: ENSDORG00000005024   Transcript: ENSDORT00000005028
Sequence length 1216
Comment pep:novel genescaffold:dipOrd1:GeneScaffold_1271:41715:170677:1 gene:ENSDORG00000005024 transcript:ENSDORT00000005028 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGAGSQHHPPGAAGGTAAAAAPAATAAASAGPGEDSSDSEAEQEGPQKLIRKVSTSGQI
RTKXXXXXXXXXXXXXXXXXXXXXXXXLRGHTLYYAKDSKSLIFDEVDLSDASVAEASTK
NANNSFTIITPFRRLMLCAENRKEMEDWISSLKSVQTREPYEVAQFNVEHFSGMHNWYAC
SHARPTFCNVCRESLSGVTSHGLSCEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXVAMPHQWLEGNLPVSAKCVVCDKTCGSVLRLQDWKCLWCKTMVHTACKDLYPPVCPLG
QCKVSIIPPIALNSTDSDXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXLRLFQKFDNFRILVCGGDGSVGWVLSEIDKLNLHKQCQLGVLPLGTGN
DLARVLGWGGSYDDDTQLPQILEKLERASTKMLDXXXXXXXELKLPPKASLPPEAPEEFY
MTIYEDSVASHLTKILNSDEDAVVISSAKILCETVKDFVAKVEKEYDKRMENAVVAEAVA
SKCSVLNEKLEQLLQALHTDCQTAPVLPGMGPAILEEDTVESSSEESLCESKDQLLDDIT
KPSSQKAVKPREIMLRANSLKKAVRQVIEEAGKVMEEPTVGPWEPASQPCDPHGAGLDGP
KDEARADDNREPLTVRTAPRSPDARAYRGCLHADSVPGSAVTATKENLPVLNTRIICPGL
RAGLAASIAGSSIINKMLLANIDPFGATPFIDPDLDSIDGYSEKCVMNNYFGIGLDAKIS
LEFNNKREEHPEKCRSRTKNLMWYGVLGTRELLQRSYKNLEQRVQLECDGQYIPLPSLQG
IAVLNIPSYAGGTNFWGGTKEDDIFAAPSFDDKILEVVAIFDSVQMAVSRVIKLQHHRIA
QCRTVKITIFGDEGLPVQVDGEAWVQPPGIIKIVHKNRAQMLTRDRXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXSLTRESATEIAINVKALYNETESLLVGRVPLXXXXXXXXXVSSA
LHSVEVELQKLTEIPWLYYILHPNEDEEPPMDCTKRNNRSTVFRIVPKFKKEKVQKQKTS
LQPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDLGIPKVGHMKRI
LQGIKELGRSTPQYEV
Download sequence
Identical sequences ENSDORP00000004703 ENSDORP00000004703

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]