SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000004725 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSDORP00000004725
Domain Number - Region: 288-316
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0432
Family Classic zinc finger, C2H2 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000004725   Gene: ENSDORG00000005052   Transcript: ENSDORT00000005050
Sequence length 517
Comment pep:novel scaffold:dipOrd1:scaffold_4304:3895:16431:1 gene:ENSDORG00000005052 transcript:ENSDORT00000005050 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASVLSRRLGKRSLLGARVLGPGASDGPAGTGAPSEPPPPLELPEGAIPQPTLASKDPAC
QEQPKEARKALGTPGLQQVAFQPGQKVRVWHGGQERLGLVERHRWAEDEVTVWLLDQKLQ
VCCKAEEVWLAERQGPCPQGPPQEHGARGPAYRPVSRNIDVPKRKSDAVEMDEMMAAMVL
TSLSCSPVVQSPPRAETNFPASSRVACGDPWKESGDVSDSGSSTTSGHWSGSSGVSTPSP
PHPQASPKYLGDAFGSPQTDHGFETDPDPFLLDEPAPRKRKNSVKVMYKCLWPNCGKVLR
SIVGIKRHVKALHLGDTVDSDQFKREEDFYYTEVQMKEESAVAAPGPSVPGPPSAEPVPA
PRVTSPSLAALPLPPPKASYPRPEPSGLESPLPSGALSTSAPGSFWHIQADHAYQALPSF
QIPVSPHIYTSISWAAAPATTPLSPVRSRSLSFSEPPPLPAPAVKSHLVVTSPPRAPSST
RKARGEAKKCRKVYGIEHRDQWCTACRWKKACQRFLD
Download sequence
Identical sequences ENSDORP00000004725 ENSDORP00000004725

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]