SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000004738 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000004738
Domain Number 1 Region: 618-700
Classification Level Classification E-value
Superfamily BRCT domain 5.76e-18
Family BRCT domain 0.0082
Further Details:      
 
Domain Number 2 Region: 723-801
Classification Level Classification E-value
Superfamily BRCT domain 0.0000000000157
Family BRCT domain 0.067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000004738   Gene: ENSDORG00000005061   Transcript: ENSDORT00000005064
Sequence length 804
Comment pep:novel genescaffold:dipOrd1:GeneScaffold_3781:274:154091:1 gene:ENSDORG00000005061 transcript:ENSDORT00000005064 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VVAYVEVWSSTERENYSKTFAHQLEAMGAKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXCRTAGAHVDESLFPAVNTKEHLPGLLRKKHKCMQPKDFVPKTPENDRRLQ
RKFEKMTEELQRQKITSGPDAPVLLFECPGSVMYSPSATFRSHQNATEKRLAETKKREEL
SPTSSPVTGQPPKNPGTSFPKASCDVPHDPLCSGKLWAGSLHPSFRSLCENQDENRGGSA
RDACASSSAATMDCTRPSPPSTSPSQPRPREPVSSPPGEERSCQRDRPGEPASLDPARAA
SASEKLTGKCSLSPAVSTKDHLLAHSRPSSSTKRKRTAVDLSSSPKEKLKRRSHSRGPTL
RPDRAQPAAQPAPLSPGRGGVSYEDYFSADNLKERKSEAPGSLPPLCRSLSKKERRGVLE
RSDFSCMGEKSRPVHMSNLAAKTNSCLHKPAVDNMRPTSSCVALEEPAAVEQGPGHDRQA
GPLQRGGSRSAESTHPHGADRSPCPAEPSGGLRPGQSPGEDVRERTGTESAQKEGXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVKNGPARHDFPDKPCTGFQNL
VRPEEPKKSGKGKKPTRTLVMTSMPSEKQNVVIQVVKKLHGFSFSPEVCETTTHVLAGRP
LRTLNVLLGMARGCWVLSYEWVLWSLELGHWISEEPFELSTHFPAAPVCRRERQLSAGQY
QGTLFADQPLMFITPASSPPRAKLCELVLLGGGRVSPTSQRAVIVIGPYTGKKKATVKYL
SEKWVLDSITQHKVCDFENYLSLQ
Download sequence
Identical sequences ENSDORP00000004738 ENSDORP00000004738

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]