SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000004897 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000004897
Domain Number 1 Region: 760-968
Classification Level Classification E-value
Superfamily ADP-ribosylation 2.3e-77
Family Poly(ADP-ribose) polymerase, C-terminal domain 0.00000000382
Further Details:      
 
Domain Number 2 Region: 479-602
Classification Level Classification E-value
Superfamily WGR domain-like 1.12e-40
Family WGR domain 0.000000241
Further Details:      
 
Domain Number 3 Region: 621-739
Classification Level Classification E-value
Superfamily Domain of poly(ADP-ribose) polymerase 6.67e-40
Family Domain of poly(ADP-ribose) polymerase 0.000000972
Further Details:      
 
Domain Number 4 Region: 72-174
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 5.7e-31
Family PARP-type zinc finger 0.007
Further Details:      
 
Domain Number 5 Region: 347-425
Classification Level Classification E-value
Superfamily BRCT domain 0.00000000107
Family DNA ligase 0.0063
Further Details:      
 
Domain Number 6 Region: 2-60
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000000314
Family PARP-type zinc finger 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000004897   Gene: ENSDORG00000005234   Transcript: ENSDORT00000005235
Sequence length 972
Comment pep:novel genescaffold:dipOrd1:GeneScaffold_3567:13259:36602:-1 gene:ENSDORG00000005234 transcript:ENSDORT00000005235 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SPMFDGKVPHWHHFSCFWKMGHCIRQPDVEVDGFSELRWDDQQKVRRTAEAGGVVGKGAD
GTGGKAEKMLGDFAAEYAKSNRSTCKGCMEKIEKGQVRLSKKMLDPKKPQLGMIDRWYHP
NCFVKNREELGFRPEYSASQLKGFSLLATEDKEALKKQLPGVKSEGKRKGDEVDGTGEVV
KKKSKKEKDKDSKLEKALKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKPLSNMKVLTLGK
LSRNKDEVKAEVEKLGGKVTGTASKASLCISTKKEVDKMSKKMEEVKEANIRVVSEDFLQ
DVSTSTKTLQELFSVHILSPWGAEVKTEPVEEAPRGKSGAVLSKKSKGPAKEEGPNKSEK
RMKLTLKGGAAVDPDSGLEHSAHVLEKGGRVFSATLGLVDIMKGTNSYYKLQLLEGDKEN
RYWIFRSWGRVGTVIGSNKLEQMPSKEDAVEHFMKLYEEKTGNAWHSKNFTKYPKKFYPL
EIDYGQDEEAVKKLTVNPGAKSKLPKAVQELVGMIFDVESMKKAMVEYEIDLQKMPLGKL
SKRQIQAAYSILSEVQQVVSEGSNSSQILDLSNRFYTLIPHDFGMKKPPLLNNTDSVQAK
VEMLDNLLDIEDYSLLRGGSDDGSXXXXXXXXXXXXXXXXVVDKDSEEAEIIRKYVKNTH
ATTHNAYDLEVVDIFRIDREGESQRYKPFRQLHNRRLLWHGSRTTNFAGILSQGLRIAPP
EAPVTGYMFGKGIYFADMVSKSANYCHTSQGDPIGLILLGEVALGNMYELKHASHISKLP
KGKHSVKGLGKTTPDPSASITLDGVEVPLGPGVSSGVSDTCLLYNEYIVYDIAQVNLKYL
LKLKFNFKTSLW
Download sequence
Identical sequences ENSDORP00000004897 ENSDORP00000004897

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]