SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000004934 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000004934
Domain Number 1 Region: 62-194
Classification Level Classification E-value
Superfamily Ankyrin repeat 8.63e-20
Family Ankyrin repeat 0.00048
Further Details:      
 
Domain Number 2 Region: 6-68
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00000000017
Family Ubiquitin-related 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000004934   Gene: ENSDORG00000005274   Transcript: ENSDORT00000005274
Sequence length 208
Comment pep:novel genescaffold:dipOrd1:GeneScaffold_2404:21935:29896:-1 gene:ENSDORG00000005274 transcript:ENSDORT00000005274 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FFRIANCRSDMTVRELKEELDLMAGVPFNMQCLHYLDQGILLDNTTLKFHDMVPGSIISL
GIWNHDGWAELFLAAAEGDPSKLSSLGVSEDSSFRTAHAQALRGEQWTQWVSQRAFVALY
ITSHRGHVEAVQYLLEHGASCVSKTPVGRTPLHAAAAMGRTDCVTQLVRHGASIHERDAH
GESPIGMARRLHRKQSERRMFLLYWTAK
Download sequence
Identical sequences ENSDORP00000004934 ENSDORP00000004934

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]