SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000005077 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000005077
Domain Number 1 Region: 293-349
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.56e-25
Family Classic zinc finger, C2H2 0.0064
Further Details:      
 
Domain Number 2 Region: 349-405
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.06e-23
Family Classic zinc finger, C2H2 0.0048
Further Details:      
 
Domain Number 3 Region: 236-293
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.93e-22
Family Classic zinc finger, C2H2 0.005
Further Details:      
 
Domain Number 4 Region: 390-442
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.2e-21
Family Classic zinc finger, C2H2 0.0033
Further Details:      
 
Domain Number 5 Region: 187-237
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000357
Family Classic zinc finger, C2H2 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000005077   Gene: ENSDORG00000005429   Transcript: ENSDORT00000005430
Sequence length 451
Comment pep:novel scaffold:dipOrd1:scaffold_8503:4740:6366:1 gene:ENSDORG00000005429 transcript:ENSDORT00000005430 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TTTTVPGCQDYIVNLQGGTDRDPELNTLICQQREKTFYHISTNTKSVVTLQSDFANIKTK
KNCLKVSQMAIRDSSVEFCKKESQESKGLFVNEESTESKVLVSRESPHEAHLSDNPQLHL
ASAVTDVGLPLLSGQAPCQNGQLKGSPASFDCQCKDVCEPQPLLVSCSHQSTHTEGTSCS
HEHYEDRLHRHETVQAAEKLCKCDQDGKPCNQNAEPRHHQGDLKEKPYRCGQCGKSFTRS
SSLLIHHAVHTDEKPYKCDKCGKGFTRSSSLLIHHAVHTGEKPHKCDKCGKGFSQSSKLH
IHQRVHTGEKPYECGECGMSFSQRSNLHIHQRVHTGERPYKCRECGKGFSQSSNLHIHRC
IHTGEKPYQCYECGKGFSQSSDLRIHLRVHTGEKPYHCGRCGKGFSQSSKLLIHQRVHTG
EKPYECGQCGKGFSQSSNLHIHQRVHSKDPR
Download sequence
Identical sequences ENSDORP00000005077 ENSDORP00000005077

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]