SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000005158 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000005158
Domain Number 1 Region: 456-513
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.4e-25
Family Classic zinc finger, C2H2 0.0085
Further Details:      
 
Domain Number 2 Region: 316-373
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.24e-23
Family Classic zinc finger, C2H2 0.0056
Further Details:      
 
Domain Number 3 Region: 232-289
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.2e-22
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 4 Region: 400-457
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.5e-22
Family Classic zinc finger, C2H2 0.0066
Further Details:      
 
Domain Number 5 Region: 176-233
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.54e-21
Family Classic zinc finger, C2H2 0.013
Further Details:      
 
Domain Number 6 Region: 134-186
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.4e-18
Family Classic zinc finger, C2H2 0.0059
Further Details:      
 
Domain Number 7 Region: 279-311
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000039
Family Classic zinc finger, C2H2 0.0063
Further Details:      
 
Domain Number 8 Region: 363-394
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000757
Family Classic zinc finger, C2H2 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000005158   Gene: ENSDORG00000005515   Transcript: ENSDORT00000005515
Sequence length 530
Comment pep:novel scaffold:dipOrd1:scaffold_23284:16980:18638:1 gene:ENSDORG00000005515 transcript:ENSDORT00000005515 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TSSGYIIKELSPNAGSGRGEISQSHEDGGTDEFSCKEIQKAPREWEWEWSSAEGRAEGVL
VVHREESSGGGKQEGGGEAAHKHLGRPLQEHLRGLPPYLCEGRGEDGEVGSPSSGKHRPW
SGVSIRYSRTPKVHIQEKPYQCGECGKAFGYPSALVLHRRIHTGEKLHRCAECGKAFSQT
SGLAVHRRTHTGERPFTCGVCGKAFSVRANLAAHQSVHTGRKPHHCAECGKVFSQASSLA
AHRRTHTGERPYACGECGKAFNSHSHLNTHRAIHAGHRPYQCTECGKAFAQNSHLANHRR
THTGERPFPCDTCGKAFSLRSSLATHQAVHTGARPHRCTECGKAFTQNSHLARHRRTHTG
ERPYVCSECGKAFNSHSHLNTHRAIHAGHKPYQCAECGKAFARNAHLASHRRTHTGEKPY
PCDTCGKAFSMRSSLAEHQTLHTGARPHRCTECGKAFTQNSHLISHHRTHTGEKPYTCDT
CGKAFSVRSSLATHQAVHTGEKPYVCDTCGKAFGRRSNLTSHRRLHARQK
Download sequence
Identical sequences ENSDORP00000005158 ENSDORP00000005158

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]