SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000005236 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000005236
Domain Number 1 Region: 1251-1555,1619-1721
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 1.14e-78
Family RNB domain-like 0.0000871
Further Details:      
 
Domain Number 2 Region: 537-591,636-942
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 8.05e-43
Family Extended AAA-ATPase domain 0.049
Further Details:      
 
Domain Number 3 Region: 2484-2616
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.2e-16
Family Tandem AAA-ATPase domain 0.056
Further Details:      
 
Domain Number 4 Region: 2136-2228
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000000000000038
Family Tandem AAA-ATPase domain 0.06
Further Details:      
 
Domain Number 5 Region: 1099-1216,1249-1276
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.0000000197
Family Cold shock DNA-binding domain-like 0.022
Further Details:      
 
Weak hits

Sequence:  ENSDORP00000005236
Domain Number - Region: 23-69
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00397
Family HkH motif-containing C2H2 finger 0.088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000005236   Gene: ENSDORG00000005596   Transcript: ENSDORT00000005597
Sequence length 2637
Comment pep:novel genescaffold:dipOrd1:GeneScaffold_2450:6717:23521:-1 gene:ENSDORG00000005596 transcript:ENSDORT00000005597 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAVWEAERLGGLLRGDLLRPSTPGEDKPTATHNQPATLQLYCRACLVTCRSQEAFENHCS
SLEHAQMVXXXXXXXXXXXXXXXXXXXXXXXXXPDLCEYGDICVKAHSAQELQEWIQRAQ
TTELREQAAWQDGLVPYRARLLAEYQHSSSEVLVLSESIPGVSITCNQPLVHQAQEKKAQ
HRWTFAIHSADPLLHVALLKQEPGAEFSLVAPHLLPGQLYALGERFRVPSSPAEFQVGVC
VQASSFGSFEQWVAFDFGRRPVLLRKLGLQLGQTPSRGLRARPEPGRPEEVERWHTGNRC
IVRSVERTDEQVALMAKYKAPALALESSLQDLALSPITCTNYRQMMHHFLHKEEAAQQQL
VAKLTLRGQVSLKTALQTPAVGMLFAPPGALYAEVPIPSSLVPDSDQGFLLARAVSTALV
APVPAPNNTVFEVRLETRASSEQALWLLLPPRCCVALGLRPETSPTLEVQFQIDPLTFRL
WHQAVDALPEERLVVPDLPACVLPHPCPIPPALPGNRKQKLAMGLIAGSCPESLKPTPPL
LIYGPFGTGKTYTLAMAALEVIRQPHTKVLICTHTNSAADIYIREYFHGFASAGHPEAAP
LRVMYTDRPPNQTDPATLKYCCLTPDGRAFRLPTGAELAQRRLVVTTSSQARELRVPVGF
FSHILIDEAAQMLECEALIPLAYASPRTRVVLAGDHMQVTPRLFSVARTKAAVHTLLYRL
FLHYQQGAHDLARQSRIIFHENYRSSAAIISFVSRHFYVAKGTPVHASGKVPCHPRHYPL
MFCHVAGSPERDLSMTSWLNAAEVVQVVEKVQEAYNTWPACWGSREQRHICAVSHGAQVG
ALRQELRRRNLGEVSVGNFEILPGREFRVVVLSTVHNRHSLLSPGAPTLEFFTDARVLNT
VMTRAQSQLVAVGDAVALCSFGACSKLWKSFIRECIEHRSVCPEGLSLGQIEQGVAQRQQ
WTTERSWAGVVRDGVLAERAGGPSPEHRAAVAKVLPGLASEAEQGDGGPAPKEGTPVGAA
AGESVAPEAAAQETALETVAEDLESDFWPLDWELNADDAILKELLDESRQVMVTVGEDGL
LDTMARPASPQQAQQYTNLPQSTLQKLLRTEPELYRRCTFLQETFERASAIPLDDGSPSP
LQVRGRLNCGMAFTGDEVLVQVLGPVAGDRASQRLQGRVVGVLKRRRRELAFVCRMDEWD
PRIMIPINSSVTKIFVAELKDRRQVPIHRLFQGRVQRVRHESLAANAWRARLFWVRIVLW
RERFYYPLGIVLEVLPEASTWEHGLRALDLEHGLKAPSPDDTSVSKALQKYHSELRTAAG
HREDCRSFLTFTVDPTGACNLDDALSVRDLGTGCEVAVHIADVASLLPRDGALDVEARRQ
GSVFYAPDREPMLMLPASLCQDALSLLPGRDRLAISLFLTMEKGSGQLQRLRFAPSIVRS
DCQLSYEEAEMLIKGHRGAGLALPACLDSVGACVVAACYFSQALRRHRLQAACPYERLDE
DSELGFRAAHIMVQEYMIQFNSLVAKFLVDHERTGAVTPLRWQPTPSSHQLDAVGEKHRE
LVPLSLHLRHHLRPRGSPAARLHLLTSLWKNIQLAAHSQDYGQMVDLIATDDMHPSLACA
SLDFRKALGRSVFCRAGRGRQQPAGHYSLQVEWYTWATSPIRRYLDLVLQRLVLLALDCG
GSAYSTREIDRLCQDFSRQYACAQSYQRRAYSLYLATQLQAQPRDKLGFVVDMEPGARCF
KLLFPANPDTLPDFYPVSYRSLQLAEHPYSLVGRPGLRLVWRLRXXXXXXXXXXXXXXXX
XXXXXXXXXXXXTLWRQLLLLAEEQQWPELAALVQDQGAAKTWPHETGRVSHSHCGNVTE
VTRELGSGDTLQVQLGARLQRGFLAPTLQLWKVAPGFSLCLEHTERPGDCFSGHPCRASQ
DQYCSADEYAQVWGPICSLDSAINAVTAGDSITLQDVHISWDRKGTPPGQLQGAFSLDPA
FLRENGIDTNFGCSYLCIRLEGLPAPPCPASAPSSLSPRLSIDPDTYTWAAHGLAHSWNQ
EDSEDGREAPGQVHFFIHHMAMEKIPEEVQRPSTQFTVEVLSKPLPDLRKEEAVRQLKNA
SPLVTSIALGKPIPKPHGKVMASRFLERLAYDIPGGGHKLNLSQNTAVRRALQRPFTVIQ
GPPGTGKTVVGLHIIFWFHKSNQEQTPPRGGPEGEGPQGAPRIIYCGPSNKSVDVLAGLL
LSKRKELRPLRVYGEQYEAVDFPMPGVGGRGLLSKTSQEGRPNPKLRSITLHHRIRQPSN
PWAQEVRAFDARLQQGEVFSKEDLALYRKTLTKALKFELDQHSVLLCTCXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLRRPPSLLGHAGRESCAVIFGHL
QGREQVLMVSTDEGSENSRANPDEVAEVVRITKQLTLDRTVDPKDIAILTPYNAQAAMIG
QALKKEGVSGVTVSSITKSQGSEWRYVLVSTVRTCPRSDVDGRPTKSWLRKFLGFVVDPN
QVNVALTRAQEGLCLIGDHILLRCCPLWCRLLEFYKAQNSLVPAKQVRVRRRSAVCS
Download sequence
Identical sequences ENSDORP00000005236 ENSDORP00000005236

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]