SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000005246 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000005246
Domain Number 1 Region: 8-126
Classification Level Classification E-value
Superfamily POZ domain 7.65e-32
Family BTB/POZ domain 0.000000977
Further Details:      
 
Domain Number 2 Region: 583-639
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.67e-21
Family Classic zinc finger, C2H2 0.0081
Further Details:      
 
Domain Number 3 Region: 624-676
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.78e-17
Family Classic zinc finger, C2H2 0.015
Further Details:      
 
Domain Number 4 Region: 527-583
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000286
Family Classic zinc finger, C2H2 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000005246   Gene: ENSDORG00000005608   Transcript: ENSDORT00000005608
Sequence length 706
Comment pep:novel scaffold:dipOrd1:scaffold_5955:19687:32083:-1 gene:ENSDORG00000005608 transcript:ENSDORT00000005608 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASPADSCIQFTRHASDVLLNLNRLRSRDILTDVVIVVSREQFRAHKTVLMACSGLFYSI
FTDQLKCNLSVINLDPEINPEGFCILLDFMYTSRLNLREGNIMAVMATAMYLQMEHVVDT
CRKFIKASEAEMVPTMKPPREDFLNSRMLMPQDIMAYRGREVVETSLPLRNTPGCESRAF
APSLYSGLSTPPASYPMYSHLPVNGFLFPDEELRDARMPVANPFPKERALPCDSTRPVHG
EYSRPAMEMPPSVCHSNIYSPKDAVPDEARSDMHYSVAEGPKPAAPSARNAPYFPCDKTS
KEEERPSSEDEIALHFEPPNAPLNRKGLVSPQSPQKSDCQPNSPTESCSSKNACILQASG
SPPAKSPTDPKACNWKKYKFIVLNNLNQNAKPEGPEQAELSRLSPRAYPAPPACQPPMEP
ENLDLQSPTKLSASGEDSTIPQASRLNNLVNRSLTGSPRNSSESHSPLYMHPPKCTSCGS
QSPQHAEMCLHTAGPTFSEEMGETQSEYSDSSCENGAFFCNECDCRFSEEASLKRHTLQT
HSDKPYKCDRCQASFRYKGNLASHKTVHTGEKPYRCNICGAQFNRPANLKTHTRIHSGEK
PYKCETCGARFVQVAHLRAHVLIHTGEKPYPCEICGTRFRHLQTLKSHLRIHTGEKPYHC
EKCNLHFRHKSQLRLHLRQKHGAITNTKVQYRVATTDLPPELPKAC
Download sequence
Identical sequences ENSDORP00000005246 ENSDORP00000005246

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]