SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000005302 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000005302
Domain Number 1 Region: 271-469
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.19e-49
Family DBL homology domain (DH-domain) 0.00011
Further Details:      
 
Domain Number 2 Region: 460-597
Classification Level Classification E-value
Superfamily PH domain-like 3.41e-19
Family Pleckstrin-homology domain (PH domain) 0.026
Further Details:      
 
Domain Number 3 Region: 579-641
Classification Level Classification E-value
Superfamily SH3-domain 0.00000517
Family SH3-domain 0.0061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000005302   Gene: ENSDORG00000005667   Transcript: ENSDORT00000005668
Sequence length 642
Comment pep:novel genescaffold:dipOrd1:GeneScaffold_453:52:32926:-1 gene:ENSDORG00000005667 transcript:ENSDORT00000005668 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MESQRSEELENPWRKSESGSWKISDELTQVRPELLSEDQEHPQSEEEGQDKEHHHISIQR
NSIFNRAMRHRSRARGSPRRSSSCLADAPENRTSVDEPSSLPQSRPHWRRLMQTTGPGAQ
GLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLLYQEYRDX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXAMFELVTSEASYYKSLNLLVSHFMENERL
KKILHPSEAHILFSNVLDVMAVSERFLLELERRMEENIVISDVCDIVHHYAADHFSVYIT
YVSNQTYQERTYKQLLQEKAAFRELIAQLELDPKCRGLPFSSFLILPFQRITRLKLLVQN
ILKRVEERSERECTALDAHKELEMVVKACNEGVRKMSRTEQMISIQKKMEFKIKSVPIIS
HSRWLLKQGELQQMSGPKTSRTLRTKKLFREIYLFLFNDLLVICRQIPGDKYQVFDSAPR
GLLRVEELEDQGQTLANVFILRLLENADDREATYMLKASSQSEMKRWMTSLAPNRRTKFV
SFTSRLLDCPQVQCVHPYVAQQPDELTLELADILNILEKTEN
Download sequence
Identical sequences ENSDORP00000005302 ENSDORP00000005302

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]