SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000005357 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000005357
Domain Number 1 Region: 2-45
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000113
Family Classic zinc finger, C2H2 0.018
Further Details:      
 
Weak hits

Sequence:  ENSDORP00000005357
Domain Number - Region: 36-64
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00104
Family Classic zinc finger, C2H2 0.016
Further Details:      
 
Domain Number - Region: 72-97
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0029
Family Classic zinc finger, C2H2 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000005357   Gene: ENSDORG00000005724   Transcript: ENSDORT00000005724
Sequence length 480
Comment pep:novel genescaffold:dipOrd1:GeneScaffold_523:9697:42537:-1 gene:ENSDORG00000005724 transcript:ENSDORT00000005724 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KHDDDRRFTCPVEGCGKSFTRAEHLKGHSITHLGTKPFECPVKGCCARFSARSSLYIHSK
KHLQDVGAPKSRCPVSSCSRLFTSKHSMKAHVVRQHSPRPDLVPQLEAPSSLTPSSELNS
PSQSELSNIDLAALFSDTPAQGSSSAGASDEALNSGILTIDVTSVSTSLGASLPTNNSSL
GPMDPLVLVAHSDIPPSLDSPLVLGTAATVLQPGSFGADEVQAMSSGAVGCLVALPMKNL
AQDTSVLTSTSNLVPVTTPASSSTSQETLSVPELLAPIKMEHDSLPVPTVARQHEESQVL
PLSVLSSPAEGHSAQKDTAPGAGTGLLYLESGGSARTDYRAIQLVKKKKQKGAGSDAEVS
ESSQRKMESGKNSPPSFHTSLGRGACESPTVAHGDLPGPASAAEVQRGAQDQVQWEGQDD
PSGEGVLPLALSPHPSTFYPCFSMDLPVCVLQEALPAPTGSTGPGAPYVPGSTINLQDLQ
Download sequence
Identical sequences ENSDORP00000005357 ENSDORP00000005357

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]