SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000005360 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000005360
Domain Number 1 Region: 317-374
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.96e-25
Family Classic zinc finger, C2H2 0.0032
Further Details:      
 
Domain Number 2 Region: 401-458
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.57e-24
Family Classic zinc finger, C2H2 0.0058
Further Details:      
 
Domain Number 3 Region: 485-542
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.24e-24
Family Classic zinc finger, C2H2 0.006
Further Details:      
 
Domain Number 4 Region: 527-579
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.46e-20
Family Classic zinc finger, C2H2 0.0046
Further Details:      
 
Domain Number 5 Region: 364-396
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000017
Family Classic zinc finger, C2H2 0.0087
Further Details:      
 
Domain Number 6 Region: 448-480
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000157
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 7 Region: 238-288
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000459
Family Classic zinc finger, C2H2 0.016
Further Details:      
 
Domain Number 8 Region: 182-233
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000813
Family Classic zinc finger, C2H2 0.025
Further Details:      
 
Weak hits

Sequence:  ENSDORP00000005360
Domain Number - Region: 277-311
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000132
Family Classic zinc finger, C2H2 0.021
Further Details:      
 
Domain Number - Region: 149-192
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0916
Family Classic zinc finger, C2H2 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000005360   Gene: ENSDORG00000005729   Transcript: ENSDORT00000005728
Sequence length 581
Comment pep:novel scaffold:dipOrd1:scaffold_68759:2506:4248:1 gene:ENSDORG00000005729 transcript:ENSDORT00000005728 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EAIGFENLQQGPCKAVSVQSERISLFQGHDSYCAIRELWQDEKQRGRSEKKQSKPESCVS
FCNKATRACERDCEHEDTEKMVPVHTHLAPSEKRFPSCDSCGESSEPLGSLYNHSRNNLT
ETVDEKTEYSDIFTRMNFPTTVNAREDRQCQPLLSQKQALTQHWKVPTEDNLYSFSDYVK
LFTQDLPLSKHQEICAEEKQPECHKHERVFAQKSQLAISQRICIGGKPWICTELEDFSLV
SNHQKTQSEENSHARAKYGRTFIQNSDLLRCPRNHAGEKHYEYSTCGESISQNSILKTHK
KLYTTNQHFKCTECGKAFTRKSTLSMHQKIHTGEKPYVCTECGKAFIRKSHFITHERIHT
GEKPYECSDCGKSFIKKSQLHVHQRIHTGENPFICSECGKVFTHKTNLIIHHKIHTGERP
YICTVCGKAFTDRSNLIKHQKIHTGEKPYKCSDCGKSFTWKSRLRIHQKCHTGERHYECN
ECGKAFIQKSALSMHQRIHRGEKPYVCPECGKAFFHKSHFITHERIHTGEKPYECSGCGK
SFTKKSQLHVHQQIHTGEKPYRCAECGKAFTDRSNLFTHQK
Download sequence
Identical sequences ENSDORP00000005360 ENSDORP00000005360

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]