SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000005505 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000005505
Domain Number 1 Region: 375-612,645-712
Classification Level Classification E-value
Superfamily NAD kinase/diacylglycerol kinase-like 4.36e-54
Family Diacylglycerol kinase-like 0.021
Further Details:      
 
Domain Number 2 Region: 1-117
Classification Level Classification E-value
Superfamily EF-hand 3.68e-44
Family EF-hand modules in multidomain proteins 0.00000414
Further Details:      
 
Domain Number 3 Region: 185-252
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.00000000000000254
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.013
Further Details:      
 
Domain Number 4 Region: 254-323
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.0000000000538
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.012
Further Details:      
 
Domain Number 5 Region: 46-67,113-182
Classification Level Classification E-value
Superfamily EF-hand 0.00000000154
Family EF-hand modules in multidomain proteins 0.00057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000005505   Gene: ENSDORG00000005880   Transcript: ENSDORT00000005880
Sequence length 733
Comment pep:novel genescaffold:dipOrd1:GeneScaffold_431:11701:30712:1 gene:ENSDORG00000005880 transcript:ENSDORT00000005880 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAKERGLISPEDFAQLQKYMEYSTKKVSDVLKLFEDGEMAKYLQGDAIGYEGFQQFLKIY
LEVEQVPIHLSQALFQSFRTGHCLNEAMIKDVVCLSDVSCYFSLLEGGRPEDKLEFTFKL
YDTDRNGILDSSXXXXXXXXXXXXXXXXXXXXXXXXPILQEMMKEIDYDGSGSVSLAEWV
RAGATTVPLLVLLGMEMTLKDDGQHMWRPKRFPRPVYCNLCESSIGLGKQGLSCNLCKYT
VHDQCAMKAMPCEVSTYAKSRKDIGIQSHVWVRGGCESGRCDRCQKKIRTFHSLTGLHCV
WCHLEIHDDCLQNMGPECDGGLLRDHILPPSSIYPSVLASGQDRKHSKTSQKTLEDLNLC
TSEALRIDPVSNTHPLLVFVNPKSGGKQGQRVLWKFQYILNPRQVFNLLKDGPEPGLRFF
RDVPDCRILVCGGDGTVGWILECIDKANLPVVPPVAVLPLGTGNDLARCLRWGGGYEGQN
LAKILKDIEMSKVVHIDRWSVKIPQQTEEKCDPVPFHIINNYFSIGVDASIAHQFHIMRE
KYPEKFNSRMKNKLWYFEFATSESIFSTCKRLEDSLTVEICGKPLDLTNLSLEGIAVLNI
PSMHGGSNLWGDTKRPQGDICGINQALGTTAKVITDPDILKTCVPDLSDKRLEVVGLEGA
IEMGQIYTKLKSAGRRLAKCSEITFHTTKTLPMQIDGEPWMQTPCTIKITHKNQMPMLMG
PPPRSHNFFGFLG
Download sequence
Identical sequences ENSDORP00000005505 ENSDORP00000005505

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]