SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000005577 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000005577
Domain Number 1 Region: 23-75
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.14e-21
Family HkH motif-containing C2H2 finger 0.00013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000005577   Gene: ENSDORG00000005955   Transcript: ENSDORT00000005955
Sequence length 180
Comment pep:novel genescaffold:dipOrd1:GeneScaffold_2416:320:12002:1 gene:ENSDORG00000005955 transcript:ENSDORT00000005955 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ANSTSVNGHLLTGQHLFSLPFLSRFYCDYCDTYLTHDSPSVRKTHCSGRKHKENVKDYYQ
KWMEEQAQSLIDKTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGPPRPGMMPAPHMGG
PPMMPMMGPPPPGMMPVGPAPGMRPPMGGHMPMMPGPPMMRPPARPMMVPTRPGMTRPDR
Download sequence
Identical sequences ENSDORP00000005577 ENSDORP00000005577

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]