SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000005686 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000005686
Domain Number 1 Region: 192-242
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000496
Family Classic zinc finger, C2H2 0.0071
Further Details:      
 
Domain Number 2 Region: 1747-1792
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000438
Family Classic zinc finger, C2H2 0.0029
Further Details:      
 
Domain Number 3 Region: 638-668
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000323
Family C2HC finger 0.085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000005686   Gene: ENSDORG00000006074   Transcript: ENSDORT00000006074
Sequence length 2394
Comment pep:novel genescaffold:dipOrd1:GeneScaffold_2511:90877:128100:-1 gene:ENSDORG00000006074 transcript:ENSDORT00000006074 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDPEQSVKGTKKVEGSPRKRLTKGEAVQTSVSSSTPYASSSTSATQESTSQELLAPQPFP
GPSSVLREGSQEKMGQQQKPPRRPSIEASVHISQLPQHPLTPAFLSPGKPEHLLEGSTWQ
LVDPMRPGPSGSFVTPGLHPQSQLLPSHASILPPEELPGIPKVFVPRPSQVTLKTTEEAH
KKERKPQKPGKYICQYCSRPCAKPSVLQKHIRSHTGERPYPCGPCGFSFKTKSNLYKHRK
SHAHRIKAGLASGSGSELYPPGLEMERIPGEEFEEPTEGESTDSDEETATTSGPPTEASP
RPKHPLLSSSLYSSGSHSSSHERCSLSQSSMATSLEDPTPFVEPSSEHPLSHKPEDTHTI
KQKLALRLSERKKVIDEQAFLSPGSKGSTESGYFSRSESAEQQVSPPNTNAKSYAEIIFG
KCGRIGQRTTMLTATSTQPLLPLSAEDKPSLVPLSVPRTQVIEHITKLITINEAVVDTSE
IDSVKPRRSSLTRRSSMESPKSSLYRDPLSSHGEKTKPEQSLLSLQHPPSTTPPVPLLRS
HSMPSAACTISTPHHTFRGSYSFDDHITDSQAPSHSSPVFTSHPRMLKRQPAIELPLGGE
YSSEEPGPSSKDAASKPSEEPELKESELTKKTKKGSKPKGMTYECTICGARYKKKDNYEA
HKKYYCSELQITKPLSAGARASPEAEKGQAEHEPWSQMMHYKLGATLELTPLRKRRKEKS
LGDEEEPPAFELTKSQFSSPGPSDTARNLPMEPTKSPAEPSKSLEGTTSFQPRTPKPGSG
SESGKERRTTSKEISVIQHTSSFEKSDPLEQSSGLEGEDKPLAQFSTLPPAPPGRPAHSL
QPRLVRQPNIQVPEILVSEEPDRPDTEPEPPPKEPEKTEEFQWPQRSQTLAQLPAEKLPP
KKKRLRLAEMAQSSGESSFESSVPLSRSPSQESSISLSGSSRSASFDREDHGKVEVPGPS
SEVRSKPTGTHMLTVPSHHPHAREMRRSASEQSPNVSHSTQMTEARSKSFDYGSLSLAGP
AAATPAAPPTPAAPPERRKCFLVRQASLSRPPEAELEATPKGRQESEEPQPSSSKSSAKS
SVPQISLAVTSHTGHPGSKSQVQDRPPLGSTPPYTEALQVFHTPVAQLPLQEKPYLPPPV
SLFSFQHLLQHEPGQSSDFMATQAMAGLLSSPYSMPPLPPSVFQAPPLPLQPTVLHPSQL
HLPQLLPHPASIPFRQPPSFLPMPHPASSALSSGFYLPVPSPFALQLPGEVESHLPPIKT
SPAPLATGPSGPSSSTEFSSNIRLPPVAPLTSSPEPTAALPPALPACVDSGASLVVPVRI
QTNMPSYGRAMYTTLSQTLVTQSPGSSVSVGLPKCEELPAAGTAVCGTDVYDTRLGPSGL
SEEQSRSFQTPYLRVPAAFPERKGTSSSSEGVSSLEGSSSTAGGSKRVLSPAGSLELTME
TQQQKRVKEEEASKVHEKLELVKPCSVVLTSPEDGKRPEKSHQVSQGLGRREPEALSSLS
SDPSDPEVPPLSHHPTLPHGTASSSEALKDYAQSSGKPHRRGLCPLSMKQEDSKEQLDLP
PLAPPSSLSLSEISSRTAKSQEGTDSKKVLQFPSLHTTTNVSWCYLNYIKPNHIQHADRR
SSVYAGWCISLYNPNLPGVSTKAALSLLRSKQKVSKETYTMATAPHPESGRLVPASSHKP
RMTEVHLSSLVSPEGQKDITRVEKEEEKRGKPEEDAPASKRGEPARIKIFEGGYKSNEEY
VYVRGRGRGKYVCEECGIRCKKPSMLKKHIRTHTDVRPYVCKHCHFAFKTKXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXTSDDMFQDSEGREGSEAVEEHQFSDLEDSDLDSDADLDE
DEEEDEEESEEESSRPSSEAPPLGLPATLQEDSSPAQGPPASDATSDNKATRDSSVSEAE
NLTASSCSTSSQSIPGLSRLGLAPLGPGEKDTGSALSSKTVSPPRSWSPSKEVGSQPPLT
RKHSLTKIDSSPQRCSPELQTSVTSXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQKAESPSASCSPGPAHPFSSQPFLVPHDF
HSHSPAQTENIFSHLPLHSQHLSRAPCPLIPIGGIQMVQARPGIHPALLPGPSTAWVSGF
SGGGSDTGAREAQERGRWSPTGSSSASVSPVAKVSKFTLSSELESRDDPKEKEKMGRGPG
RPPDEPRRAESPSDPMPIHSPCTPQLPQGHQVAQSWSPHLESLPILANPADSASPPLDRS
SSMGCLADASARFTARRRNLSGEPRTRQDSPEPPGSGGPRVPPPPPEDRGPLST
Download sequence
Identical sequences ENSDORP00000005686 ENSDORP00000005686

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]