SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000005747 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSDORP00000005747
Domain Number - Region: 523-741
Classification Level Classification E-value
Superfamily NHL repeat 0.000207
Family NHL repeat 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000005747   Gene: ENSDORG00000006141   Transcript: ENSDORT00000006139
Sequence length 749
Comment pep:novel genescaffold:dipOrd1:GeneScaffold_4550:19005:57737:-1 gene:ENSDORG00000006141 transcript:ENSDORT00000006139 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTKPLPLVLCFTLVVVRVWGSSTPSTGTSEPDVQTVGPTEDETLQNEADNQENVLSQLLG
DYDKVKAVSEGSDCQCKCVVRPLGRDACQRINKGASRKEDFYTVETITSGSSCKCACVAP
PSALNPCEGDFRLQKLREADIQDLKLSTIIDMLEGAFYGLDLLKLHSVTTKLVGRVDKLE
EEVSKNLTKKNEQVKEDMEEIPMEMNKRGKENHSENTLDSMQDLRSALQRDAAAAYAHQE
YEERFLQEETVSQQINSIKLLQTRPLAPPEVVKPQRPLQRQVHLRGRPASKPTVIRGITY
YKAKVSEEENDMEEQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXRCKDTLSTITGPTTQNTYGRNEGAWMKDPLAKDERIYVTNYYYGNTLVE
FRNLENFKQGRWSNSYKLPYSWIGTGHVVYNGAFYYNRAFTRNIIKYDLKQRYVAAWAML
HDVAYEEATPWRWQGHSDVDFAVDENGLWLIYPALDDESFSQEVIVLSKLNAVDLSTQKE
TTWRTGLRRNFYGNCFVICGVLYAVDSYNQRNANISYAFDTHTNTQIVPRLLFENEYSYT
TQVDYNPKDRLLYAWDNGHQVTYHVIFAY
Download sequence
Identical sequences ENSDORP00000005747 ENSDORP00000005747

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]