SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000005763 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000005763
Domain Number 1 Region: 2-200
Classification Level Classification E-value
Superfamily (Trans)glycosidases 2.42e-66
Family Bee venom hyaluronidase 0.00025
Further Details:      
 
Weak hits

Sequence:  ENSDORP00000005763
Domain Number - Region: 262-280
Classification Level Classification E-value
Superfamily EGF/Laminin 0.027
Family EGF-type module 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000005763   Gene: ENSDORG00000006155   Transcript: ENSDORT00000006155
Sequence length 313
Comment pep:novel scaffold:dipOrd1:scaffold_11453:2421:9843:-1 gene:ENSDORG00000006155 transcript:ENSDORT00000006155 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KLIADMQKNLSATDMEYLARATFEKSAKAFMKETIKMGIKSRPKGLWGYYLYPDCHNYNV
YAPNYTGSCPEEEVLRNNELSWLWNSSTALYPSIGVKRSFRDSETILRFSKFRVHESLRI
STMTSHEYALPVFVYTRLGYREEPLFFLSKQDLISTIGESAALGAAGVVIWGDMNLTSSE
ANCTKVKRFVSSDLGSYIVNVTRAAEVCSVHLCRNNGRCIRKVWEAPDYLHLNSASYHID
ASEAGDFIVNGRASEGDLAVMAEKFSCHCYLGYGGPDCRETKEADGCSGPLSFSGSLITT
CVLLLTGYCNIHL
Download sequence
Identical sequences ENSDORP00000005763 ENSDORP00000005763

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]