SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000005782 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000005782
Domain Number 1 Region: 131-179
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000542
Family Classic zinc finger, C2H2 0.014
Further Details:      
 
Domain Number 2 Region: 390-441
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000414
Family Classic zinc finger, C2H2 0.028
Further Details:      
 
Domain Number 3 Region: 671-719
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000268
Family Classic zinc finger, C2H2 0.028
Further Details:      
 
Weak hits

Sequence:  ENSDORP00000005782
Domain Number - Region: 452-476
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000569
Family Classic zinc finger, C2H2 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000005782   Gene: ENSDORG00000006177   Transcript: ENSDORT00000006175
Sequence length 766
Comment pep:novel scaffold:dipOrd1:scaffold_79372:1098:3425:-1 gene:ENSDORG00000006177 transcript:ENSDORT00000006175 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LFSPIKPVQTGKTLVPSSSSSSSSSGAETPKQAFFHLYHPLGSQHSFSAGGVGRSHKPTP
APSSALPGSTEQLVTSPHLAFPGTTGLLAAQCLGATKGLEATASPGLLKPKNGSGELGYG
EVMGPLEKTGGRHKCRFCAKVFGSDSALQIHLRSHTGERPYKCNVCGNRFTTRGNLKVHF
HRHREKYPHVQMNPHPVPEHLDYVITSSGLPYGMSVPPEKAEEEAVTPGGGVERKPLVAS
TTALSATESLTLLSTGAGTATAPGLPAFNKFVLMKAVEPKNKADENTPPGSEGSAISGVA
ESGTAARMQLSKLVTSLPSWALLTNHFKSTGSFPFPYVLEPLGASPSETSKLQQLVEKID
RQGAMAVGSTASGAPTTSAPAPSPSASSGPNQCVICLRVLSCPRALRLHYGQHGGERPFK
CKVCGRAFSTRGNLRAHFVGHKASPAARAQNSCPICQKKFTNAVTLQQHVRMHLGGQIPN
GGTTLPESGGTAQENGSEQSAISGAGSFPPQQQTQQPSPEEELSEEEEEEEEEEEDVTDE
DSLAGRGSESGGEKAISVRGDSEEASGAEEEAGIAIAVASGKERDGNEKATQQCSLPPPP
PPDIVDQPQPMEQDSYDVSGGKEEGAKPERSSSPATSLPQEGEGTCTPLVEELSLQETVR
KEPGENSSRKACEVCSQTFPTQTALEEHQKTHPKEGLLFTCVFCRQSFLERATLKKHMLL
AHHQVPPFAPHGPQNIATLSLVPSCSPSIASPGISPFPRKDDPAIP
Download sequence
Identical sequences ENSDORP00000005782 ENSDORP00000005782

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]