SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000005969 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000005969
Domain Number 1 Region: 22-194
Classification Level Classification E-value
Superfamily Lysozyme-like 2.06e-19
Family G-type lysozyme 0.0000117
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000005969   Gene: ENSDORG00000006377   Transcript: ENSDORT00000006376
Sequence length 194
Comment pep:novel scaffold:dipOrd1:scaffold_20697:12137:18997:1 gene:ENSDORG00000006377 transcript:ENSDORT00000006376 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSALWLLLGLLALTCSSESSNWGCYGNIRTLNTPGASCGIGRRHGLTYCGVRASERLAEI
DMPYLLRYQPMMRTIGRRYCVDPAVIAGVLSRESQGGNILVNVGDGDRMVQDSSFYPSPS
WINESQISQATQLLTARIKDIQTRFPTWTPGQYLRGGLCSYSGGPGFVKSSHDLSCDFCN
DVLARAKYFKQHGF
Download sequence
Identical sequences A0A1S3FGR6
ENSDORP00000005969 XP_012875239.1.60039 ENSDORP00000005969

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]