SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000005974 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000005974
Domain Number 1 Region: 133-357
Classification Level Classification E-value
Superfamily RCC1/BLIP-II 5.75e-48
Family Regulator of chromosome condensation RCC1 0.0055
Further Details:      
 
Domain Number 2 Region: 24-140
Classification Level Classification E-value
Superfamily Ankyrin repeat 7.65e-20
Family Ankyrin repeat 0.0023
Further Details:      
 
Domain Number 3 Region: 761-865
Classification Level Classification E-value
Superfamily POZ domain 5.23e-17
Family BTB/POZ domain 0.0087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000005974   Gene: ENSDORG00000006378   Transcript: ENSDORT00000006381
Sequence length 1345
Comment pep:novel genescaffold:dipOrd1:GeneScaffold_39:11615:59351:-1 gene:ENSDORG00000006378 transcript:ENSDORT00000006381 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNSPVPDCTARCRSLEHALDILSAITKGSENQIKAFLSSHCYNAATTKDAFGRNALHLAS
SCGKKGVLDWLMEKGADPLVRDKESGWTALHRSIFYGHIDCAWSLLKHGVSLYMQDKEGL
SPLDLLMKDRPAHVVFKNTDPTDVYTWGDNTNFTLGHGSQNSKHHPELVDFFSRTGVPIK
QVVLCKFHSVFLSQKGQVYTCGHGPGGRLGHGDEQTCLVPRLVEGLSGHNCAQVAAAKDH
TVVLTEDGCVYTFGLNIFHQLGIIPPPSSCNVPRQMQAKYLKGRTIVGVAAGRFHTVLWT
REAVYTMGLNGGQLGYLLDPNGEKCVTAPRQVSALHHDISLSLVASDGATVCVTTRXXXX
XXXXXXXXXXXXXQLNLKKILVSGGRMEYKVDPEHLKENGGQKICILAMDGAGRVFCWRS
ATSSLKQCRWAYPRQVLISDIALNRNELLFVTDGEFKGKWFEEKRKNSEKKDILSNVHHS
SSEVSCVSDTNSMYERIRLEKLTFAHRAVSVSTDPSGCNFAILQSDPKAXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXLDGVRFENEKINVIAKKTGNKLKLNQKKCSFLCDVTMKSVDGKEFPCHK
CVLCARLEYFHSMLSSSWIEASSCASLEMPMHSEILKVIDYLYTDEAVVIKESQNVDFIC
SVLVVADQLLIIRLKEVCEVALTEKLTLKNAAMLLEFAAMYNAEQLKLSCLQFIGLNMAA
VLEARSLDVLSEDVLKDLSVFYWKMIPAMDRRVITPYQEGPDISYLEVEDGDVFLKEEIN
MEQNYSETMFKKAKAKAKKKPRKRSDSSGGYNLSDIIQSLPPTGLLKTGKTNSVESLPEL
LTSDSEGSCAGVGSPRESQSPDLTTSSHSEKMEAKVKPYSNGTPPAYTREDLKPWEKSSV
LQITAPQSIPSNRADTTSSSSWVSGSFSPVSPPVVDLRTIMEIEESRQKCGTTPKSNLGK
VISHGVRLSQKQRKMIALTTKENSSGASGVETVLTAPSKSPKPAXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNSIHVAPGPEGSHISDLPPLESPNP
WLSSLTPPSTVAPVTFASIVEEELQQEAALIRSREKPLALIQVEERAIQELMVFYEASGN
PDEFVVVERAPQGPLAVPMWNKHGC
Download sequence
Identical sequences ENSDORP00000005974 ENSDORP00000005974

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]