SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000005980 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000005980
Domain Number 1 Region: 510-562
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.24e-18
Family Classic zinc finger, C2H2 0.0041
Further Details:      
 
Domain Number 2 Region: 488-518
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000188
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number 3 Region: 424-463
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000205
Family Classic zinc finger, C2H2 0.024
Further Details:      
 
Weak hits

Sequence:  ENSDORP00000005980
Domain Number - Region: 9-81
Classification Level Classification E-value
Superfamily Tropomyosin 0.0412
Family Tropomyosin 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000005980   Gene: ENSDORG00000006388   Transcript: ENSDORT00000006388
Sequence length 626
Comment pep:novel genescaffold:dipOrd1:GeneScaffold_5807:5646:14889:-1 gene:ENSDORG00000006388 transcript:ENSDORT00000006388 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ISPWTMAATIQAMERKIESQAARLLSLEGRTGMAEKKLADCEKTAVEFGNQLEGKWAVLG
TLLQEYGLLQRRLENVENLLRNRNFWILRXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXYAISKPEVLSQIEQGKEPCSWRRAGPKVPEVPVDPSPGSGPSVPAPDLLMQI
KQEGELQLQEQQALGVEAWAAGQPDIGEEPWGLSQLDSGAGDISTDATSGVHSNFATTIP
PTSWQADLPPHHPSSACSDGTLKLSTAASTEDVKIVIKTEVQEEEVIATPVHPTDLEAHG
ALFAPQAARFFPSPIQEGAWESQGSAFPGQDPVLGLREPSRPERDMGDLRPAVAQEEVPA
GDWLFGGVRWGWNFRCKPPVGLNPRTGPEGLPFSSDNGEVILDPSQIPRPFNEPCKYPGR
TKGFGHKPGQKKHPPAPPGGRPFTCATCGKSFQLQVSLSAHQRSCGLPDGAGTASSTTGS
GGRDSNALRCGECGRCFTRPAHLIRHRMLHTGERPFPCTECEKRFTERSKLIDHYRTHTG
VRPFTCTVCGKSFIRKDHLRKHQRNHPAIAKAPAHGQPLPPLPPLPAAPPDPFKSPAAKG
PLASTDLVADWTCGLGVLGPADAGDL
Download sequence
Identical sequences ENSDORP00000005980 ENSDORP00000005980

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]