SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000005993 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000005993
Domain Number 1 Region: 6-126
Classification Level Classification E-value
Superfamily POZ domain 5.49e-23
Family BTB/POZ domain 0.0029
Further Details:      
 
Domain Number 2 Region: 296-344
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000004
Family Classic zinc finger, C2H2 0.0037
Further Details:      
 
Domain Number 3 Region: 334-378
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000119
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Weak hits

Sequence:  ENSDORP00000005993
Domain Number - Region: 272-307
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000682
Family Classic zinc finger, C2H2 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000005993   Gene: ENSDORG00000006402   Transcript: ENSDORT00000006402
Sequence length 441
Comment pep:novel genescaffold:dipOrd1:GeneScaffold_352:85522:86847:-1 gene:ENSDORG00000006402 transcript:ENSDORT00000006402 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSERSDLLHFKFENYGDSMLQKMNKLREENKFCDVTVLIDDTEVQGHKIVFAAGSPFLRD
QFLLNDSREVKISILQSSEVGRQLLLSCYSGMLEFPEMELVNYLTAASFLQMSHIVERCT
QALWKFIKPKQPMDSKEGCEPQSASPQTKEQQGDARGSPKQDSPCMHPSEDSMDMEDSDI
QIVKVESIGDVSEVRSKKNQNQFISSEPTALHSSEPQHSLINSTVENRVSEIEQNHLHNY
ALSYTGSDNIIMTSKDVFGPNIRGVDKGLQWHHQCPKCTRVFRHLENYANHLKMHKLFMC
LLCGKTFTQKGNLHRHMRVHAGIKPFQCKICGKTFSQKCSLQDHLNLHSGDKPHKCNYCD
MVFAHKPVLRKHLKQLHGKNSFDNANERNVQDLTVDFDSFACTTVTDSKGCQPQTDATQV
LDAGKLAQAVLNLRSDSTCVN
Download sequence
Identical sequences A0A1S3FJT5
XP_012876791.1.60039 ENSDORP00000005993 ENSDORP00000005993

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]