SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000006017 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSDORP00000006017
Domain Number - Region: 430-496
Classification Level Classification E-value
Superfamily NHL repeat 0.0628
Family NHL repeat 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000006017   Gene: ENSDORG00000006427   Transcript: ENSDORT00000006427
Sequence length 555
Comment pep:novel scaffold:dipOrd1:scaffold_10070:21159:50524:1 gene:ENSDORG00000006427 transcript:ENSDORT00000006427 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAPGAERGRRAAGWGLRGALAAVALLSALNAAGTVFALCQWRGLSAALRALEAQRGREQR
EAGALRAFLAELSRAPRGPPAPPPPDPAIAARNKRSHGGEPAPPPPHVRGESQDMLMMMT
YSMVPIRVMVDLCNSTKGICLTGPPGPPGPPGVDGLPGHNGSDGPPGAEGPRGEKGANGK
RGKMGLPGATGNPGEKGEKGDPGELGSPGNEGPPGQKGEKGDKGDVSNDVLPAGAKGDQG
PPGPPGPPGPPGPPGPPGRGRSKGLRQPNVFNGQCPGETCAIPNDDTLEGKVDEKVSDHQ
PPQAESMITSIGNPTRVLKVKETFGTWIRESANKSDDRIWVTEHFSGIMVKEFKDEPALL
NGSYSLIHLPHYFHGCGHAVXXXXXXXXXXXXXXXXXFEFGKETSQTLKLENALYFDRKY
LFANSKTYFNLAVDEKGLWIIYASSVDGSNILVAQLEEKTFSVVQHINTTYPKSKAGNAF
VARGILYVTDTKDTRITFAFDLLGGKQINANFALRTSQSVLAMLSYNMRDQRLYSWEDGQ
LMLYPVHFLSATLHQ
Download sequence
Identical sequences ENSDORP00000006017 ENSDORP00000006017

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]