SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000006070 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000006070
Domain Number 1 Region: 811-908
Classification Level Classification E-value
Superfamily BRCT domain 1.23e-22
Family BRCT domain 0.072
Further Details:      
 
Domain Number 2 Region: 644-720
Classification Level Classification E-value
Superfamily BRCT domain 1.96e-17
Family DNA ligase 0.011
Further Details:      
 
Domain Number 3 Region: 575-650
Classification Level Classification E-value
Superfamily BRCT domain 0.00000000000222
Family BRCT domain 0.046
Further Details:      
 
Domain Number 4 Region: 64-119
Classification Level Classification E-value
Superfamily BRCT domain 0.000000000064
Family DNA ligase 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000006070   Gene: ENSDORG00000006482   Transcript: ENSDORT00000006483
Sequence length 1008
Comment pep:novel genescaffold:dipOrd1:GeneScaffold_4271:4796:39964:-1 gene:ENSDORG00000006482 transcript:ENSDORT00000006483 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VIRLLKAGKAKEVSYNALASHIISEDGDSPEVGEAREVFDLPVVKXXXXXXXXXXXXXXX
VNGFSPESCQIFFGITACLSQVSSEDRSALWALLTFHGGSCQLSLNKKCTHLIVPEPKGX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIIYEEEEEDDEEDEAEYEEQDS
QNEGSTEDKSSLASSREGSPGNRQFSPPITETSKGELMFDDSSDSSPEKQERNLNWTPAE
VPQLATAKRRLPQGKESGLINLCANVPPVPGNLLPPYVRGLMASGQILPTSERSDMISTW
SPAARTLRNITNSADIQHINRPSNVAHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXPQVHQHQFPQQPLHRPPQHAQPFQPQQALQLHQLQHSLLQQQHM
QQQQLQRLHHQQQQQHMQNQAAAQHLSQPPQALPHQVPPQQPPPHPPQPPPPQQLFGHDP
TVEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIIQAHGGTVDPTFTSRCTHLLCESQ
VSSLYAQAIRERKRCITAHWLNTVLKKKKMVPPHRALHFPVAFPPGGKPCAQHIISVTGF
VDNDRDDLKLMAYLAGAKYTGYLCRSNTVLICKEPSGLKYEKAKEWRIPCVNAQWLGDIL
LGNLEALRQVQCSRYTAFNLQDPFAPTQHLVLSLLDAWRIPMKVSAELLMXXXXXXXXXX
XXXXXXXXXXXXXXIEDLPPPTKKLTPELTPFVLFTGFEPVHVQQXXXKLYILGGEVAES
TQKCTHLIASKVTRTVKFLTAISVVKHIVTPEWLEECFKCQRFIDEQNYVLRDAEAEVLF
SFSLEESLKRAHVSPLFKAKYFYITPGICPSLSTMKAIVECAGGKVLSKQPSFRKLMEHK
QNKSLSEIILISCENDLHLCREYFARGIDVHNAEFVLTGVLTQTLDYE
Download sequence
Identical sequences ENSDORP00000006070 ENSDORP00000006070

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]