SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000006079 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000006079
Domain Number 1 Region: 12-129
Classification Level Classification E-value
Superfamily POZ domain 3.37e-27
Family BTB/POZ domain 0.0016
Further Details:      
 
Domain Number 2 Region: 417-473
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.18e-23
Family Classic zinc finger, C2H2 0.008
Further Details:      
 
Domain Number 3 Region: 304-359
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.49e-21
Family Classic zinc finger, C2H2 0.0085
Further Details:      
 
Domain Number 4 Region: 346-398
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.13e-16
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 5 Region: 462-514
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.45e-16
Family Classic zinc finger, C2H2 0.0053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000006079   Gene: ENSDORG00000006492   Transcript: ENSDORT00000006492
Sequence length 698
Comment pep:novel genescaffold:dipOrd1:GeneScaffold_6572:78756:91564:-1 gene:ENSDORG00000006492 transcript:ENSDORT00000006492 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KMAETSAEPSGQLVVHSDTHSDTVLASFEDQRKKGFLCDITLIVENVHFRAHKALLAASS
EYFSMMFAEEGEIGQSIYMLEGMVADTFSLLLEFIYTGYLHASEKSTEQILATAQFLKVY
DLVKAYADFQNNHSAPKPSTLNRAGTPVVVISNKKNDPPKRKRGRPRKVSSLQEGKSEPA
VEEEIQLRVNNSVQNRQNFVAKEGGSVVLNEQIAAKEKEESEPVCEPGRVEEVPAEKDEN
RDPKNQDGQDSQSRYSKRRTRRSVKLKDYKLVGDEDDQGSAKRMCGKRKRPSGPEARCKD
CGKVFKYNHFLAIHQRSHTGERPFKCNECGKGFAQKHSLQVHTRMHTGERPYTCTVCNKA
LTTKHSLLEHMSLHSGQKSFTCDQCGKYFSQKRQLKSHYRVHTGHSLPECNHCHRKFMDV
SQLKKHLRTHTGEKPFTCEICGKSFTAKSSLQTHIRIHRGEKPYSCSICGKSFSDSSAKR
RHCILHTGKKPFSCPECSLQFARLDNLKAHLKIHSKEKQASDSSSVSGSGNAEEVRNLLQ
LQPYQLSASGEQEIQLLVTDSVHNINFMPGPSQGISIVAAESSQNMTADQAANLTLLTQQ
PEQLQSLILSAQPEQTEHIQSLSMIESQMEPSQTEPVHVITLSKETLEHLHAHQEQTEEL
RLAASATDPAQHLQLTQEPDPLPTHHVAQPTPLGQEQS
Download sequence
Identical sequences ENSDORP00000006079 ENSDORP00000006079

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]