SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000006116 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000006116
Domain Number 1 Region: 337-394
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.93e-25
Family Classic zinc finger, C2H2 0.0039
Further Details:      
 
Domain Number 2 Region: 281-338
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.34e-25
Family Classic zinc finger, C2H2 0.0033
Further Details:      
 
Domain Number 3 Region: 169-226
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.74e-24
Family Classic zinc finger, C2H2 0.0039
Further Details:      
 
Domain Number 4 Region: 225-282
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.24e-23
Family Classic zinc finger, C2H2 0.0042
Further Details:      
 
Domain Number 5 Region: 131-183
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.62e-20
Family Classic zinc finger, C2H2 0.0035
Further Details:      
 
Domain Number 6 Region: 379-431
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.83e-19
Family Classic zinc finger, C2H2 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000006116   Gene: ENSDORG00000006530   Transcript: ENSDORT00000006530
Sequence length 451
Comment pep:novel scaffold:dipOrd1:scaffold_51666:3593:4948:-1 gene:ENSDORG00000006530 transcript:ENSDORT00000006530 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
WKSMGEPEEFAPKQELCQAQPCQKITGELADIGLDYSSLKEEYKCEGNLEGQPGNEKTSC
KKETVTYEEALLNKQEQEYDKFWGSFHQNSLLPIQQIIPKQEKVYNQDTHKNTFKKAFMA
IKPKSVFAGKKVLKCNDCEKVFTQSSSLTLHQRIHTGEKPYKCAECGKAFSQRSNLVQHH
RIHTGERPYECKECNKAFSQNAHLLQHLRVHTGEKPYECKVCRKAFGQFAYLSQHQRVHT
GEKPYECIVCGKAFSNRSSIAQHHRVHTGEKPYKCNVCGKAFSLRAYLTVHQRIHTGERP
YECKECGKAFSQNSHLAQHQRIHTGEKPYKCQQCRKAFSQIAYLAQHQRVHTGEKPYECI
KCGKAFSNDSSLTQHQRVHTGEKPYECNVCGKAFSYCGSLTQHQRIHTGERPYECKECKK
SFRQHAHLTHHQRIHVGVVFSRPNPGSHHVL
Download sequence
Identical sequences ENSDORP00000006116 ENSDORP00000006116

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]