SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000006156 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000006156
Domain Number 1 Region: 202-377
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.71e-25
Family Ankyrin repeat 0.0013
Further Details:      
 
Domain Number 2 Region: 542-648
Classification Level Classification E-value
Superfamily POZ domain 2.09e-22
Family BTB/POZ domain 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000006156   Gene: ENSDORG00000006572   Transcript: ENSDORT00000006573
Sequence length 730
Comment pep:novel genescaffold:dipOrd1:GeneScaffold_2971:90211:137892:-1 gene:ENSDORG00000006572 transcript:ENSDORT00000006573 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VLSLPAYFSPYNGGSLGHDERADAYAQLELRTLEQSLLATCVGSISELSDLVSRAMHHMQ
GRHPLCAGTSPARQARQPPQPITWSPDALHTLYYFLRCPQMESMENPNLDPPRMTLNNER
PFMLLPPLMEWMRVAITYAEHRRSLTVDSGDIRQAARLLLPGLDCEPRQLKPECCFSSFR
RLDARAATERFNQDLGFRMLNCGRTDLISQAIEALGPDGVNTMDDQGMTPLMYACAAGDE
AMVQMLIDAGANLDIQVPSNSPRHPSIHPDSRHWTSLTFAVLHGHISVVQLLLDAGAHVE
GSAVNSGEDSYAETPLQLASAAGNYELVSLLLSRGADPLLSMLEANGMASSLHEDMNCFS
HSAAHGHRNVLRKLLTQPQQAKADVLSLEEILAEGVEESDTSSQGSGSEGPLRLSRTRTK
ALQEAMYYSAEHGYVDITMELRALGVPWKLHIWIESLRTSFSQSRYSVVQSLLRDFSSIK
EEEYNEELVTEGLQLMFDILKTSKNDSVIQQLATIFTHCYGTSPIPSIPEIRKTLPARLD
PHFLNNKEMSDVSFLVEGKLFYAHKVLLVTASNRFKTLMTNKSEHDGDSSKTIEISDMKY
HIFQLMMQYLYYGGTESMEIPTADILELLSAASLFQLDALQRHCEILCSQTLSVESAVNT
YKYAKIHNAPELALFCEGFFLKHMKALLEQDAFRQLIYSRSSKVQGLDPLQDLQSTLAER
VHSVYVTSRV
Download sequence
Identical sequences ENSDORP00000006156 ENSDORP00000006156

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]