SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000006254 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000006254
Domain Number 1 Region: 303-360
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.36e-26
Family Classic zinc finger, C2H2 0.0041
Further Details:      
 
Domain Number 2 Region: 191-248
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.26e-25
Family Classic zinc finger, C2H2 0.0043
Further Details:      
 
Domain Number 3 Region: 359-416
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1e-22
Family Classic zinc finger, C2H2 0.008
Further Details:      
 
Domain Number 4 Region: 247-304
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.62e-22
Family Classic zinc finger, C2H2 0.0083
Further Details:      
 
Domain Number 5 Region: 405-457
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.97e-19
Family Classic zinc finger, C2H2 0.0061
Further Details:      
 
Domain Number 6 Region: 136-192
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.12e-18
Family Classic zinc finger, C2H2 0.0088
Further Details:      
 
Domain Number 7 Region: 99-147
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000413
Family Classic zinc finger, C2H2 0.0078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000006254   Gene: ENSDORG00000006674   Transcript: ENSDORT00000006674
Sequence length 495
Comment pep:novel scaffold:dipOrd1:scaffold_21003:11025:12546:1 gene:ENSDORG00000006674 transcript:ENSDORT00000006674 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LMSLSDCLGAAGKKTTECEDEMMSDGVPVTETARESEWGSPGQLGSPRPQGPGFEQGTVT
HWKIQTGETAQVGSKSGRNSILNSNLLILQRDFIEREAHSCGICGKSFLFNSDLVRHQVS
HAGEKPYTRDQCGKGFGPLSHLTEHQRVCTGDRVYVCDACGKDFIHYPSLIEHQQSHAGE
KPFKCSQCGKAFCHSSDLLRHQRVHTRERPFECKECGKGFSQSSLLIRHQRIHTGERPYE
CNECGKAFIRSSSLIRHYQIHTEVRQYECRDCGKAFRHRSDLIEHQRIHTGERPFECREC
GKAFIRSSKLIQHQRIHTGERPYVCNECGKRFSQTSNFTQHQRIHTGEKLYECNECGKAF
FLSSYLIRHQKIHTGERVYECKACGKAFLQKAHLTEHQKIHTGDRPFECKDCGKAFIQSS
KLLLHQIVHTGEKPYACSHCGKGFIQRSNFLQHQKMHTEERLHECAVQQEGLPLSEATLH
LGERATEEVQVGDAE
Download sequence
Identical sequences ENSDORP00000006254 ENSDORP00000006254

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]