SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000006258 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000006258
Domain Number 1 Region: 7-130
Classification Level Classification E-value
Superfamily ArfGap/RecO-like zinc finger 2.49e-34
Family Pyk2-associated protein beta ARF-GAP domain 0.0018
Further Details:      
 
Domain Number 2 Region: 253-362
Classification Level Classification E-value
Superfamily PH domain-like 1.42e-20
Family Pleckstrin-homology domain (PH domain) 0.0095
Further Details:      
 
Domain Number 3 Region: 140-219
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000173
Family Pleckstrin-homology domain (PH domain) 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000006258   Gene: ENSDORG00000006678   Transcript: ENSDORT00000006678
Sequence length 383
Comment pep:novel genescaffold:dipOrd1:GeneScaffold_5964:1392:23439:1 gene:ENSDORG00000006678 transcript:ENSDORT00000006678 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGDRERNKKRLLELLQAAGTGNAYCADCGAADPDWASYKLGIFICLHCSGVHRNFPDVSK
VKSVRLDFWDDSIVEIAVVLQFMTHNGNLRVKAKFEARVPAFYYIPQANDCLVLKEQWIR
AKYERQEFMADGKTVSSSGNREGILWKRGRDNAQFLRRRFVLLAREGLLKYYTKEESKGP
AVISIKLNAFQTEKIGHPHGLQIYKREGRTRNLFVYHESGKXXXXXXXXXXXXXXXXXXX
XXXXXXXXXLVPFITRNYLKQGFMEKTGPKQREPFKKRWFALDPQERRLLYYKNPLDAFE
QGQVFLGSSEQGYEVCEDLPRGVRGNRWKAGLTIVTPERKFILTCPSEKEQREWLESLGD
VLSRPLSPLHLHLLTASADSGSR
Download sequence
Identical sequences ENSDORP00000006258 ENSDORP00000006258

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]