SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000006354 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000006354
Domain Number 1 Region: 399-449
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.15e-17
Family Classic zinc finger, C2H2 0.008
Further Details:      
 
Domain Number 2 Region: 189-239
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000193
Family Classic zinc finger, C2H2 0.0095
Further Details:      
 
Domain Number 3 Region: 357-416
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000161
Family Classic zinc finger, C2H2 0.0063
Further Details:      
 
Domain Number 4 Region: 441-493
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000069
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 5 Region: 149-199
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000566
Family Classic zinc finger, C2H2 0.0075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000006354   Gene: ENSDORG00000006783   Transcript: ENSDORT00000006782
Sequence length 540
Comment pep:novel genescaffold:dipOrd1:GeneScaffold_1943:22620:26591:-1 gene:ENSDORG00000006783 transcript:ENSDORT00000006782 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPRRKQSHPQPVKCEGVKAETEDSLDEPGALVLESDLLLGQDLEFXXXXXXXXXXXXXXX
XXXXXXXXXXDSLGARPGLPYGLSDDESGGGRALSAESEVEEPARGPGEARGERPGPACQ
LCGGPTGEGPCCGAGGPGGGPPLPPRLLYSCRLCAFVSHYSSHLKRHMQTHSGEKPFRCG
RCPYASAQLVNLTRHTRTHTGEKPYRCPHCPFACSSLGNLRRHQRTHTGPPTPPCPTCGF
RCCAPRPARPPSPTEQEGAVPRRPEDALLLPDLSLHVPPGGTSFLPDCGQLRGEGEGLCV
TGSEPLPELLFPWTCRGCGQELEEGEGSRLGSAMCGRCMRGEAGGGASGGPQGPSDKGFA
CSLCPFATHYPNHLARHMKTHSGEKPFRCARCPYASAHLDNLKRHQRVHTGEKPYKCPLC
PYACGNLANLKRHGRIHSGDKPFRCSLCNYSCNQSMNLKRHMLRHTGEKPFRCATCAYTT
GHWDNYKRHQKVHGHGGAGGPGLSAPEGWAPPHSPPTVLSTRGSTALGATGSRALHTDSP
Download sequence
Identical sequences ENSDORP00000006354 ENSDORP00000006354

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]