SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000006389 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000006389
Domain Number 1 Region: 663-810
Classification Level Classification E-value
Superfamily NAD kinase/diacylglycerol kinase-like 4.58e-18
Family NAD kinase-like 0.034
Further Details:      
 
Domain Number 2 Region: 178-238
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.00000000000000254
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.00039
Further Details:      
 
Domain Number 3 Region: 2-120
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000000103
Family Pleckstrin-homology domain (PH domain) 0.013
Further Details:      
 
Domain Number 4 Region: 107-167
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.000000000297
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.02
Further Details:      
 
Weak hits

Sequence:  ENSDORP00000006389
Domain Number - Region: 314-343
Classification Level Classification E-value
Superfamily NAD kinase/diacylglycerol kinase-like 0.00159
Family NAD kinase-like 0.091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000006389   Gene: ENSDORG00000006816   Transcript: ENSDORT00000006819
Sequence length 1048
Comment pep:novel genescaffold:dipOrd1:GeneScaffold_3764:50465:108816:-1 gene:ENSDORG00000006816 transcript:ENSDORT00000006819 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KILKEGPLLKNCTSFKRWKLRYFLVQGQKLYFAHHPAXXXXXXXXXXXXXXXXXXXXXXX
XXXXVITPERKVTLAASNRKDMEEWINILKTVQQGEVRKIPAAENNPFLIGMHYWYSSHS
PRTQHCNVCRETIPALSRDAIICEVCKVKSHRLCALRANKDCKWNTLSITDDLLLPADEI
TMPHQWVEGNMPISSQCAVCHESCGSYERLQDFRCLWCNATVHSDCRRRFSKECCFGTHR
SSIVPPTALSDPKGDXXXXXXXXXXXXXXXXXXXXXXXXXXXFQSGDHQGVLRKQYYSQV
FDLSKGEAGLCMFKNFARFRVLVCGGDGSVSWVLSLVDAFGLHERXXXXXXXXXXXXXXX
XXXGWGAFWSKKSPLDILNRVEQASVRTLDRWSVMIRETPRKVPLLKGQVEMDVPEFEXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXFLCSSAEDFVIDIVKTWQQIKQNNTAVESVI
LKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXLDKETRQTISVKNFTSTLLLGDEDSEDFNQMSPRHXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXSRFKNKIWYGLLGGKELLQRSYRKLEERLHLECDGEVISLPNLQGIVVLNITSYAGG
VNFWGSNTATTEYEAPAIDDGKLEVVAIFGSVQMAMSRIINLHHHRIAQCREVMITIDGE
EGIPVQVDGEAWVQRPGLIKIRYKNAAQMLMRDRDFENSMKIWENKHTEIQAIPQPQLDS
QESQDSLSDEEYAQMKHLAQLAENLISSLNDLSKVHQHVSVLMDSVNASTNILNDLFYPQ
DTDSEAAAVYCTPIETLSRNDAVDVTFSLKGLYDDTKAFLEENLLRNAEDNTTLQNALDA
MNREFEKLSEIAWMNPILVPEEKSSDTDSRSLRIKAKFLKFGKKKLEEEDKPKAAPRFHG
FLGNLWHRRYRKDETKGDDLPTSSSSQL
Download sequence
Identical sequences ENSDORP00000006389 ENSDORP00000006389

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]