SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000006392 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000006392
Domain Number 1 Region: 127-162
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000146
Family Classic zinc finger, C2H2 0.06
Further Details:      
 
Weak hits

Sequence:  ENSDORP00000006392
Domain Number - Region: 4-35
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00204
Family HkH motif-containing C2H2 finger 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000006392   Gene: ENSDORG00000006821   Transcript: ENSDORT00000006822
Sequence length 594
Comment pep:novel genescaffold:dipOrd1:GeneScaffold_4963:5669:29856:-1 gene:ENSDORG00000006821 transcript:ENSDORT00000006822 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ITWNEQRKAELFTNDFCHICGVVLQFESQRISHYKXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXVHMRTYICRICRIIFTSLNMFRSHMQGSEHQIKESFVINLVKNSKKTQNHYQ
DECANYIKVQKSRELDSTTCFRKMEDNSLETHGYREVDSRRRFKIFEQNIPFEPFQTYSG
PYNNPQAVENQLPHHLPTHSKTQDSFQDELEDYIKVQKSRGLEPKTCFRNMRENFMNHEY
RETVDSGPKQRMAQQRFSFDGSHTYQQQYNPLPVEGQLPHWLTSDSNKTNDSFQNELEDS
IEVQKATGLEPKTCFGKILSISMETHKYGEMVDNRPRQRIFEQRHPFETFQHYMRPYSSS
QAMQNQFSHSLPAHDSKRRQESVNHHHHTKEYSKKPVPLSFSQHKNNSGSHSVECEVYKH
LPLENVTQDHQESHKHRHQKRKLHPGESKGRPEKEQSKHRRKKSYNLDKDESIKQNKRWE
DKVKISSGKLKHRKNKKSHEASSEKERKHKKEKKKYIEERTEEEILWDESILGF
Download sequence
Identical sequences ENSDORP00000006392 ENSDORP00000006392

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]