SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000006395 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000006395
Domain Number 1 Region: 2-333
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.96e-95
Family Ankyrin repeat 0.00000039
Further Details:      
 
Domain Number 2 Region: 400-696
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.49e-84
Family Ankyrin repeat 0.0000000357
Further Details:      
 
Domain Number 3 Region: 3456-3567
Classification Level Classification E-value
Superfamily DEATH domain 3.7e-25
Family DEATH domain, DD 0.0075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000006395   Gene: ENSDORG00000006825   Transcript: ENSDORT00000006825
Sequence length 3843
Comment pep:novel genescaffold:dipOrd1:GeneScaffold_3665:10700:176630:1 gene:ENSDORG00000006825 transcript:ENSDORT00000006825 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KGNTALHIASLAGQAEVVKVLVKEGANINAQSQNGFTPLYMAAQENHIDVVKYLLENGAN
QSTATEDGFTPLAVALQQGHNQAVAILLENDTKGKVRLPALHIAARKDDTKSAALLLQND
HNADVQSKMMVNRTTESGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASK
RGNTNMVKLLLDRGGQINAKTRDGLTPLHCAARSGHDQVVELLLERGAPLLARTKNGLSP
LHMAAQGDHVECVKHLLQHKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRANPNARA
LNGFTPLHIACKKNRIKVMELLVKYGASIQAITEXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEEQTPLHIASRLGKTEIVQL
LLQHMAHPDAATTNGYTPLHISAREGQLDVASVLLEAGAAHSLATKKGFTPLHVAAKYGS
LDVAKLLLQRRAAADSAGKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNGYTPLHI
AAKKNQMQIASTLLNYGAETNIVTKQGVTPLHLASQEGHADMVTLLLDKGANIHMSTKSG
LTSLHLAAQEDKVNVADILTKHGADKDAHTKLGYTPLIVACHYGNVKMVNFLLKQGANVN
AKTKNGYTPLHQAAQQGHTHIINVLLQHGAKPNATTAXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXTITEKHKLNVPETMTEVLDVSDEEXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXLRSFSSDRSHTLSHASYLRDSAMIEDTVVIPSHQVST
LAKEAERNSYRLSWGTENLDNVALSSSPIHSGFLVSFMVDARGGAMRGCRHNGLRIIIPP
RKCTAPTRVTCRLVKRHILATMPPMVEGEGLASRLIQIGPSGAQFLGKLHLPTAPPPLNE
GESLVSRILQLGPPGTKFLGPVIVEIPHFAALRGKERELVVLRSENGDNWKEHFCDYTED
ELNEILNGMDEVLDSPEDLEKKRICRIITRDFPQYFAVVSRIKQDSNLIGPEGGVLSSTV
VPQVQAVFPEGALTKRIRVGLQAQPMHSELVKKILGNKATFSPIVTLEPRRRKFHKPITM
TIPVPKASSDVMLNGFGGDAPTLRLLCSITGGTTPAQWEDITGTTPLTFVNECVSFTTNV
SARFWLIDCRQIQESVTFASQVYREIICVPYMAKFVVFAKSHDPIEARLRCFCMTDDKVD
KTLEQQENFSEVARSRDVEVLEGKPIYVDCFGNLVPLTKSGQHHIFSFFAFKENRLPLFV
KVRDTTQEPCGRLSFMKEPKSTRGLVHQAICNLNITLPIYTKESESDQEQEEEIDMTSEK
NDETESTETSVLSHLVNEVPVLASPDLLSEVSEMKQDLIMTAILTTXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSTK
TERHSPASPSGKTDKRPPISLTEKHPPVSPGRTEKRLPVSPSGRTEKHSPVSTTGKNDRH
LPVSPSGKTDKQPPVSPTSKTERIEETMSVRELMKAFQSGQDPSKHKTGLFEHKSVKQKQ
SQEKSKSRLEKEKGQAITQRDIQRTESIKRGQKFLVTGTPESRRRAHAIAMGLKRDEAVG
EKEKAANHKTPEPVQPASEEESHQEPDRSKEKRAEEQGEMELQISPNRKTSTDFSEVIKQ
ELESNDKYQQFCMSQETEKAQLQLDQVLTSPFNTTFPLDYMKDDFLPALSLQSGTLDSSA
EGLKPEGLAPSPCGSLMEGTPQISSEESYKHEGLAETPETSPESLSFSPKKSEEQMEETK
GITPKVETPLEIPSEKEHPTTKDRMDGCEDQGAALAEGSELASERSHREVSPDAPQPVSP
QQEGPGNSSTSLTKESPRTVPEDASSCGEGQLIPQSSAQEAQANREAQESPTTSEGMETS
PLPGASVKTDTDMGSKPQGVIRSPQGLELALPSRDSEVLSPMADESLAVSHKDSLEASPV
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXSPVPKTKAGMLSSHFPYPAAISKTELMTEVV
SMRSRLLRDPDGSAEDDSLEQTSLMESSGKSPLSPDTPSSEEVSYEVTPKATEATSAPKP
AVIQECAEEDDSENGEKKRFTPEEEMFKMVTKIKMFDELEQEAKQKRDYRKESKQEESSS
ASDPDGDCSVGLEEPKQMEGVEGERDVPVLVTSESRKASSSSESEPELTQLKKGADSGLL
SEPVIRVQPPSPLPSSMDSNSSPEEVQFQPIVSKQYTFKMNEELPEEPSTSEEEKEGEAH
LAEDRPTVSPEGVVRPCEDLNGATHQPEICDGHGCEPVSPSNSAGPVCLGHQNLSGDDVD
EQLAFQKDTPTPQDSHGNDTGGGEHDVSGIESPPGACPSESSSLLHCPISEGEKLGEGTF
STSSTTNVEVTKTDQSVESISKDCSIQDSSVPPHADSVSTASLTGDPAKADEIPDPQITS
PYENVPSPSFFSSEESKTQPDMNYTTTFHSSEGYSATMTFSVEDVEVKSSSPRTVSSERC
NFESQSLEGASEQESTSWEVQSEKASSSLEPTLSRTPEVIGEQISKVIITKTDVDADSWS
EIREDDEAFEARVKEEEQKIFGLMVDRQSQGTTPDTTPARTPTEEGTPTSEQNPFLFQEG
KLFEMTRSGAIDMTKRSYADESFHFFQIGQEAGEETLPADIKEGTPGAEPSQLEMSAESL
ALSESKETVDDEAELVPDDLSEDVEEIPDSDRHLRSHVEISASPEASTNCGGAEDLSTLQ
TDDAPSSSSMKPIPCPDSLQPAVPGQLDFSTVTRSVYSERDDESPDSSPEEEKSVIEIPT
ALMENVPSAESKSQIPTRTILTSSPAPLPAEESEFSEDSAPGLNEGSMEDEAKPKSKIPV
KASIQRGEQQLPHPDSSLQMTVTAQGRDGTSRTSDHRSKSESDACPLDSKTKCPVKARSY
IETEAESRERSEELELDSEEGASRPKIFTSRLPVKSKSSTASCKGGVSPTRESKEHFFDL
YRNSIEFFEEISDEASKLVDRLTQSENEHELASDDESSSALEVSVIENLPAVESEHSVPE
DIFDTRPIWDESIETLIERIPDDNGHDHAEDPQDEQERIEERLAYIADHLGFSWTELARE
LDFTEEQIHQIRIENPNSLQDQSHALLKYWLERDGKHATDTSLIECLTKINRMDIVHLME
TSTETLQERISHSYAEIEQTITLDHSEGFSVLPEELCTARHKQKEEQAVSKENESDDHPP
IVSEEDISGGYSTFQDCTPKAEVDPSEPVLSPQVHKEQVQQDFSGKMQDLPEDRQEYFVT
TPGTEGPKTQKATAVPASPSKTPEEIRSTPHEEERMYLHTPTSSEPSCSPIVQEPEEFPK
PKEESSPPKTSLVIEESAEVHPQALARQDTDAAFEKGDDMPDIPPETVTEEEYIDEHGHT
VVKKVTRKIIRRYVASDGTEKEEITMQGMPQEPISIEDGDGYSKVIKRVVLKSDTEQSED
NNE
Download sequence
Identical sequences ENSDORP00000006395 ENSDORP00000006395

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]