SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000006432 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000006432
Domain Number 1 Region: 12-114
Classification Level Classification E-value
Superfamily ArfGap/RecO-like zinc finger 1.7e-34
Family Pyk2-associated protein beta ARF-GAP domain 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000006432   Gene: ENSDORG00000006865   Transcript: ENSDORT00000006865
Sequence length 503
Comment pep:novel genescaffold:dipOrd1:GeneScaffold_1086:5270:33652:-1 gene:ENSDORG00000006865 transcript:ENSDORT00000006865 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGDSSMQDILAFFKRLRSVPTSKVCFDCGAKNPSWASITYGVFLCIDCSGSHRSLGVHLS
FIRSTELDSNWSWFQLRCMQVGGNANASSFFHQHGCTTNDTNAKYNSRSAQLYRERVKSL
ASQATRKHGTDLWLDSCMVPPSSPPPKEEDFFAAHATPEVSGEMHTPAPPEPFPLTPRAA
EAKAEKTEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVSSLRLAYKDLELHMKKDSKPGVSGRSQA
EAERLGMGFGACRGGVSHSVTSDMQIIEQESPTLAKPRKKYHEDDESYFTSSSRYFDEPF
SSWDDRTDSYWKRESNREPEVAVKSAGSADRPARRKPEPEPAHHTDEARKKFGNAKAISS
DMYFGRQAQTDYETRARLERLSASSSISSADLFEDEQRKQATGNYNLSSVLPSAPDMAQF
KQGVRSVAGKLSVFANGVMTSIQ
Download sequence
Identical sequences ENSDORP00000006432 ENSDORP00000006432

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]