SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000006459 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000006459
Domain Number 1 Region: 131-223
Classification Level Classification E-value
Superfamily DNA polymerase beta, N-terminal domain-like 1.29e-24
Family DNA polymerase beta, N-terminal domain-like 0.0002
Further Details:      
 
Domain Number 2 Region: 264-372
Classification Level Classification E-value
Superfamily Nucleotidyltransferase 1.57e-23
Family DNA polymerase beta-like 0.00042
Further Details:      
 
Domain Number 3 Region: 15-112
Classification Level Classification E-value
Superfamily BRCT domain 0.00000000376
Family DNA topoisomerase II binding protein 1, TopBP1 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000006459   Gene: ENSDORG00000006893   Transcript: ENSDORT00000006892
Sequence length 462
Comment pep:novel genescaffold:dipOrd1:GeneScaffold_687:56185:68313:-1 gene:ENSDORG00000006893 transcript:ENSDORT00000006892 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLPHRRRARPSGPAPAPPSGRFPGVAVYLAERRMGRSRRAFLTRLARSKGFRVLDAFSSE
VTHVVMEQTSAEEAICWQEHVATTCPDGPHPALLDITWFTESMEAGQPVPVEFRHRLEVA
EPRKGPLSPEWIPSYACQRPTPLTHHNTTLSEALDILAEAAVFEGSEGRCLSFQRASAVL
RALPSPVTSLRQLQGLPYFGEHSSRVVRELLEHGACEEVEKIRCSERTAAPPGPEHPSWA
VCGPAGAGGGSRGTDPAWGHCHTHRWLPEGLVLYHQHHPSHLGDLTYLAQQKHTMDAFER
SFCIFRLPQPPGAAEGSWSWKAVRVDLVVAPSSQFPFALLGWTGSQLFERELRRFSRKEK
GLCLNSHGLFDPEKICSRGRALGSQTGSCCRRQFSMLLLRKISSDTWALSTFPLSRETPD
PGPHPHLRNEAARCLVPHPHLCQQRLSLQGLVGPAASLIAVW
Download sequence
Identical sequences ENSDORP00000006459 ENSDORP00000006459

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]