SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000006497 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000006497
Domain Number 1 Region: 60-144
Classification Level Classification E-value
Superfamily C-type lectin-like 5.6e-21
Family C-type lectin domain 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000006497   Gene: ENSDORG00000006931   Transcript: ENSDORT00000006931
Sequence length 146
Comment pep:novel genescaffold:dipOrd1:GeneScaffold_1756:825:11837:-1 gene:ENSDORG00000006931 transcript:ENSDORT00000006931 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GCRGPCWHGLAWKLFCAAVTLLVLGVAGLSVAGVYLTQRSPTEEGTMDIQENRIETERPA
MAACPVFWHQLGEKCLFLSRTPLSWNDSLTYCSTKQCNLLLIRDGEELXXXXXXXXXXXX
LYWIGLHCSVSGKTWKWTNGSEFVSA
Download sequence
Identical sequences ENSDORP00000006497 ENSDORP00000006497

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]