SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000006587 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000006587
Domain Number 1 Region: 2-120
Classification Level Classification E-value
Superfamily POZ domain 5.89e-34
Family BTB/POZ domain 0.00059
Further Details:      
 
Domain Number 2 Region: 278-327
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000346
Family Classic zinc finger, C2H2 0.0073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000006587   Gene: ENSDORG00000007027   Transcript: ENSDORT00000007027
Sequence length 437
Comment pep:novel genescaffold:dipOrd1:GeneScaffold_4407:677:11137:1 gene:ENSDORG00000007027 transcript:ENSDORT00000007027 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEISSHQSHLLQQLNEQRRQDVFCDCSILVEGKVFKAHRNVLFASSGYFKMLLSQNSKET
CQPTTATFQAFSPDTFTVILDFVYSGKLSLTGQNVIEVMSAASFLQMTDVISVCKTFIKS
SLDISEKEKDRYFSLSDKDANSNGIDHSSFYSGSWQEESSSPRSHISPDLGTGIISGKPW
SKYNYHSVSQRNTQQPLAKYEQRKDSIKTKHLRLSQPYVAHYSSKEVRISDSSSQVSXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDLPRMRFKCPYCTHVVKRKADLKRHLRCH
TGERPYPCQACGKRFSRLDHLSSHFRTIHQACKLICRKCKRHVTDLTGQVVQEGTRRYRL
CNECLAEVGIDSLPIDLEAEQHLMSPSDGDKDSRWHLNEEENRSYVEIVEDGSADLVIQQ
VDDSEEEEEKEIKPNIR
Download sequence
Identical sequences ENSDORP00000006587 ENSDORP00000006587

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]