SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000006600 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000006600
Domain Number 1 Region: 526-610
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 6.35e-29
Family Forkhead DNA-binding domain 0.00000903
Further Details:      
 
Weak hits

Sequence:  ENSDORP00000006600
Domain Number - Region: 370-395
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0339
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number - Region: 151-253
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0637
Family ABC transporter ATPase domain-like 0.069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000006600   Gene: ENSDORG00000007040   Transcript: ENSDORT00000007040
Sequence length 738
Comment pep:novel genescaffold:dipOrd1:GeneScaffold_5838:23176:164942:1 gene:ENSDORG00000007040 transcript:ENSDORT00000007040 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMQESATETISNSSMNQNGMSTLSSQLDAGSRDGRSSGDTSSEVSTVELLHLQQQQALQA
ARQLLLQQQTSGLKSPKNSDKQRPLQELLPESKLCVCGHSSGDEHPHNTFAVPVSVAMMT
PQVITPQQMQQILQQQVLSPQQLQALLQQQQAVMLQQQQLQEFYKKQQEQLHLQLLQQQQ
QQQQQQQQQQQQQQQQQQQQQQQQQQQQPPPPPPHPGKQAKEQQQQQQQQQQLAAQQLVF
QQQLIQMQQLQQQQHLLSLQRQGLISIPPGQAALPVQSLPQXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSSHEETG
ASHTLYGHGVCKWPGCESICEDFGQFLKHLNNEHALDDRSTAQCRVQMQVVQQLEIQLSK
ERERLQAMMTHLHMRPSEPKPSPKPLNLVSSVTMSKNMLETSPQSLPQTPTTPTAPVTPI
TQGPSVITPASVPNVGAIRRRHSDKYNIPMSSEIAPNYEFYKNADVRPPFTYATLIRQAI
MESSDRQLTLNEIYSWFTRTFAYFRRNAATWKNAVRHNLSLHKCFVRVENVKGAVWTVDE
VEYQKRRSQKITGSPTLVKNIPTSLGYGAALNASLQXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXHSIHVKEEPVIAEDEDCPMSLVTTANHSP
ELEDDREIEEEPLSEELE
Download sequence
Identical sequences ENSDORP00000006600 ENSDORP00000006600

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]