SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000006616 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000006616
Domain Number 1 Region: 95-288
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.58e-20
Family Tandem AAA-ATPase domain 0.041
Further Details:      
 
Domain Number 2 Region: 414-471
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.0000000000435
Family Ankyrin repeat 0.0062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000006616   Gene: ENSDORG00000007057   Transcript: ENSDORT00000007057
Sequence length 1331
Comment pep:novel genescaffold:dipOrd1:GeneScaffold_267:427:42167:1 gene:ENSDORG00000007057 transcript:ENSDORT00000007057 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KGANRYLTVKKKDGSETAHAVMTCNLTHNTKHAVRSLIQRFPVTNKERTELLPKTERGNV
FAVEAENREMSKTSGRLNNGIPQVPVKRGESEFDAFRQSLPVFEKQEEIVNIIKENKVVL
IVGETGSGKTTQIPQFLLDDCFKNGIPCRIFCTQPRRLAAIAVAERVAAERRERIGQTIG
YQIRLESRVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDEVHERDRFSDFLLTKLR
DLLQKHPTLKLILSSAALDVNLFIRYFGSCPVIYIQGRPFEVKEMFLEDILKTTGYTNKE
MLKYKKEKQRXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDYRHSETSATALMV
AAGRGFTSQVEQLISMGANVHSKASNGWMALDWAKHFGQTEIVDLLESYXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXAGRCRPGICFRLFS
RLRFQNMLEFQTPELLRMPLQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXPVEPHKMVLCAVVKCLDPITIATLAYRDPFVLPTQASQ
KRAAMLCRKRFTAGTFSDHMALLRAFQAWQKARSDGWERAFCEKNFLSQATMEIIIGMRT
QLLGQLRASXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRENVVLTGPKE
KKVRFHPTSVLSQPQYKKIPPANGQAAAIQALPTDWLIYDEMTRAHRIANIRCCSAVTPV
TVLVFCGPARLASNALQEPSSFRADGVPNDSSDSEVEDRTTANLAALKLDEWLNFKLEPE
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGFSRMSSEIGREKSQ
DWGSAGLGGVFKVEWIRKESLPFQCAHHLLNPWNDNKKVQISRDGQELEPQVGEQLLQLW
ERLPLGKPTTD
Download sequence
Identical sequences ENSDORP00000006616 ENSDORP00000006616

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]