SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000006632 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000006632
Domain Number 1 Region: 26-118
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 9.55e-19
Family Spermadhesin, CUB domain 0.0012
Further Details:      
 
Domain Number 2 Region: 173-236
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.0000000000000051
Family Spermadhesin, CUB domain 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000006632   Gene: ENSDORG00000007077   Transcript: ENSDORT00000007076
Sequence length 575
Comment pep:novel genescaffold:dipOrd1:GeneScaffold_6730:225336:237222:-1 gene:ENSDORG00000007077 transcript:ENSDORT00000007076 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RSSCKASLGGNNLGESHKSLVLQLGANENCVWTIQKPENKNLRIIFSHIQLDPEGTCDNE
NIKVFDGNSTTGPLLGQVCSKKDFVPIFESSYSSLTVQIVTDKSTTQRTVFIFYYFFDSG
TXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEVDDKCRF
DFVAIYDGSSTNAGLIGQVCGRGTPTFESSSDSLTVVLSTDYANSYRGFSASYTSVYTEN
INTTSLICASDKMRVIISKSYLESFNYNEDNLQLNDPTCRPEVSNVVEFSIPLDGCGTVK
KVEDYSITYTNIITFIVSPTSAVITRQKHLQIIVKCEMEYNSTVEVMYITEDDVIQYQNA
LGKYNMSMVLFESDSFENPILNSPYYVDMNQTLFVQVGLSASDPNLVVFLDTCRASPTSD
FASPNYDLIKSGCSRDETCEVYPLFGHYGRFQFNAFKFLRSLNSVYLQCKVLICDSNDSH
SRCHQGCVSRKKRDISSYKWKTDSVIGPIRVKRDRSGNSGLLHQTHADIPQQPFNALHLF
SFVVLALNVVIVATITLRHFVNQRQDYKYEKLQRY
Download sequence
Identical sequences ENSDORP00000006632 ENSDORP00000006632

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]